KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101054069Help
Entry
101054069         CDS       T04350                                 

Gene name
MGAM
Definition
(RefSeq) maltase-glucoamylase, intestinal
  KO
K12047  maltase-glucoamylase [EC:3.2.1.20 3.2.1.3]
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq00052  Galactose metabolism
sbq00500  Starch and sucrose metabolism
sbq01100  Metabolic pathways
sbq04973  Carbohydrate digestion and absorption
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    101054069 (MGAM)
   00500 Starch and sucrose metabolism
    101054069 (MGAM)
 09150 Organismal Systems
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    101054069 (MGAM)
Enzymes [BR:sbq01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     101054069 (MGAM)
    3.2.1.20  alpha-glucosidase
     101054069 (MGAM)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Trefoil DUF5110 Gal_mutarotas_2
Motif
Other DBs
NCBI-GeneID: 101054069
NCBI-ProteinID: XP_010338818
LinkDB All DBs
Position
Unknown
AA seq 1826 aa AA seqDB search
MARKKLKKFTTLELVLSVLLLVLFIISVVLIVLLAKESLKSTAPDPGTTGTPVGSTIGST
HPETTGTPDRGTSGTTPVSAECPVVNELERINCIPDQPPTKATCDQRGCCWSLQGAGSIP
SCYYSENHGYHMEGDLVNTNAGFTARLKNLPSSPLFGSSVDNVLLTAEYQTSNRFHFKLT
DQTKSRYEVPHEHVQPFSGNAAAALTYQVEISREPFSIKVTRRSNNRVLFDSSIGPLLFA
DQFLQLSSRLPSANVYGLGEHVHQQYRHDLNWKTWPIFNRDTTPNGNGTNLYGAQTFFLC
LEDASGLSFGVFLMNSNAMEVVLQPAPAITYRTTGGILDFYVFLGNTPEQVVQEYLELIG
RPALPSYWALGFHLSRYEYGTLDHMREVVERNRAAQLPYDVQHADIDYMDERRDFTYDPV
DFKGFPEFVKELHNNGQKLVIIVDPAISNNSSSSKPYGPYDRGSDMKIWVNGSDGVTPLI
GEVWPGHTVFPDYTNPNCAVWWAKEFELFHNQVEFDGIWIDMNEVSNFVDGSVSGCSANN
LNYPAFIPRILDGCLFCKTLCMDAVQHWGKQYDVHNLYGYSMAVGADICGFALDAPEELC
RRWMQLGAFYPFSRNHNGQGYKDQDPASFGADSLLLNSSRHYLNIRYTLLPYLYTLFFRA
HSRGDTVARPLLHEFYGDSNTWDVHQQFLWGPGLLITPVLDEGVEKVMAYVPDAVWYDYE
TGGQVGWRKQKVEMELAGDKIGLHLRGGYIFPTQQPNTTTLASRKNPLGLIIALDENKEA
KGELFWDDGEMKDTVANKVYLFCEFSVTQNRLEVTISQSTYKDPNNLLYRAYVAFPDFFR
NSTAKWWKREIEELYNNPQNPERSLKFDGMWIDMNEPSSFVNGAVHPGCRDASLNHPPYM
PHLESRDRGLSSKTLCMESQQILPDGSPVQHYNVHSLYGWSQTRPTYEAVQEVTGQRGIV
ITRSTFPSSGRWAGHWLGDNTAAWDQLKKSIIGMMEFSLFGISYTGADICGFFQDAEYEM
CVRWMQLGAFYPFSRNHNTIGTRRQDPVSWDAAFVNISRNVLQTRYTLLPYLYTLMHKAH
TEGVTVVRPLLHEFVSDQVTWDIDSQFLLGPAFLVSPVLELNARNVTAYFPRARWYDYYT
GVDINARGEWKTLPAPLDHINLHVRGGYILPWQEPALNTHLSRKNALGLIIALDENKEAK
GELFWDDGQTKVIGRPVMVPYWSLGFQLCRYGYQNDSEIASLYDEMVAAQIPYDVQYSDI
DYMERQLDFTLNPKFAGFPALINRMKADGMRVILILDPAISGNETQPYPAFTRGVEDDVF
IKYPNDGDIVWGKVWPDFPDVVVNGSLDWDSQVELYRAYVAFPDFFRNSTAKWWKREIEE
LYNNPQNPERSLKFDGMWIDMNEPSSFVNGAVHPGCRDASLNHPPYMPFMQQTLTRLKGS
GRRSSMACAPWLYPQFTSFSPPTRAVQEVTGQRGIVITRSTFPSSGRWAGHWLGDNTAAW
DQLKKSIIGMMEFSLFGISYTGADICGFFQDAEYEMCVRWMQLGAFYPFSRNHNTIGTRR
QDPVSWDAAFVNISRNVLQTRYTLLPYLYTLMHKAHTEGVTVVRPLLHEFVSDQVTWDID
NQFLLGPAFLVSPVLELNARNVTAYFPRARWYDYYTGVDINARGEWKTLPAPLDHINLHV
RGGYILPWQEPALNTHLSRQKFMGFKIALDDEGTAEGWLFWDDGQSIDTYGKGLYYLAKF
SASQNTVQSHIIFNNYITGTNPLKLGYIEIWGVGSVPITSVSMSVSGMVITPSFNSDGTA
QVLSIDVTDRNISLHNFTSLTWRSTL
NT seq 5481 nt NT seq  +upstreamnt  +downstreamnt
atggcaagaaaaaagctgaaaaaatttactactttggagcttgtactcagtgttcttctg
cttgtgttgtttatcatcagtgttgttctaatcgtgcttttagccaaagagtcactgaaa
tcaacagccccagatcctgggacaactggtactccagttgggagtacaattggttccaca
catcctgaaacaactggcaccccagatcgtggaacatctggtaccactcctgtttctgct
gaatgtccagtggtaaatgaattggaacgaattaattgcatccctgaccagccaccaaca
aaggccacatgtgatcaacgtggctgctgctggagtctccagggagcaggaagtattccc
tcgtgttactattccgagaatcatggctaccacatggagggtgaccttgtaaacacaaat
gcaggattcacagcccggttgaaaaatctgccttcttcacccctgttcggaagcagtgtt
gacaatgttcttctcacagcagaatatcagacatcgaaccgtttccactttaagttgact
gaccaaactaaaagcaggtatgaagtgccccatgaacacgtgcagcccttcagtggaaat
gctgctgctgctttgacctaccaagttgaaatctccagagagccgtttagcatcaaagtg
accagaagaagcaacaatcgtgttttgtttgactcgagcattgggcccctcctgtttgcc
gaccagttcttgcagctctcgtcccgactgcctagtgctaacgtgtatggcctgggagag
catgtgcaccagcagtaccggcatgatttgaattggaagacctggcccatatttaacagg
gacacaactcccaacggtaatggaactaatttgtatggtgcgcagacattcttcctgtgc
cttgaagacgctagtggattgtcctttggggtgtttctgatgaacagcaatgccatggag
gttgtccttcagcccgcgccagccatcacttaccgcaccactgggggcattctcgacttc
tatgtgttcctgggaaacactccagagcaagttgttcaagaatatctagagctcattggg
cggccagcccttccctcctactgggcacttggatttcacctcagtcgttacgaatatgga
accttagaccacatgagagaagtcgtggagagaaatcgcgcagcacaactcccttatgat
gttcagcatgctgatattgattatatggatgagagaagggacttcacttatgatccagtg
gattttaaaggtttccctgagtttgtcaaggagttacacaataatggacagaagctggtc
atcattgtggatccagccatctctaacaactcttcctcaagtaaaccctatggcccatat
gacaggggttcagatatgaagatatgggtgaatggttcagatggagtcactccacttatt
ggggaggtctggcctggacacactgtgtttcctgattataccaatcccaactgtgctgtt
tggtgggcaaaggaatttgagctttttcacaatcaagtagagtttgatggaatctggatt
gatatgaatgaagtctccaactttgtcgatggctcggtctcaggatgttctgcaaacaac
ctaaattatccagcattcattcccagaatcctagatgggtgcctgttctgcaagactctc
tgtatggatgcagtgcagcactggggcaagcagtatgatgttcacaatctgtatggctac
tccatggcagtgggtgctgacatatgtggctttgccttggatgcccctgaggagctctgt
aggcggtggatgcagctgggcgcattttatccattttctaggaatcacaatggccaaggc
tacaaggaccaggatcctgcctcctttggagctgactccctgctgttgaattcctccagg
cactatcttaacatccgctatactctattgccctacctgtataccctcttcttccgtgct
cacagccgaggggatacggtggccaggccccttttgcatgagttctatggggacagcaac
acttgggatgtgcaccaacagttcttatgggggcctggcctcctcatcactccagttctg
gatgaaggtgtggaaaaagtgatggcatatgtgcctgatgctgtctggtatgactatgaa
actgggggccaagtgggatggaggaagcaaaaagtcgagatggaacttgctggagacaaa
attggacttcaccttcgaggaggctacatcttccccacacagcagccaaatacaaccact
ctggccagtcgaaagaacccccttggtcttatcattgccctagatgagaacaaagaagca
aaaggagaacttttctgggatgatggggaaatgaaggatactgtggccaataaagtgtat
cttttttgtgagttttctgtcactcagaatcgcttggaggtgactatttcacaatcaacc
tacaaggaccccaacaatttactatatcgagcttatgtggctttcccagactttttccgt
aattcaactgccaagtggtggaagagggaaatagaagaactatacaacaatccacagaat
ccagagaggagcttgaagtttgatggcatgtggattgatatgaatgaaccatcaagcttt
gtgaatggggcagttcatccaggctgcagggatgcctctctgaaccaccctccctacatg
ccacatttggagtccagggacaggggcctgagcagcaagaccctgtgcatggagagtcag
cagatcctcccagacggctccccagtgcagcactacaacgtgcacagcctgtacgggtgg
tcccagaccagacccacatatgaagctgtgcaggaggtgacgggacagcgagggattgtc
atcacccgctccacatttccgtcttctggccgctgggcaggacattggctgggagacaac
acagctgcatgggatcagctgaagaaatctatcattggcatgatggagttcagcctcttt
ggcatatcctacacaggagcagatatctgtgggttctttcaagacgccgaatatgagatg
tgtgttcgctggatgcagctgggggccttttaccccttctcaagaaaccacaacaccatt
gggaccaggagacaagaccctgtatcctgggatgctgctttcgtgaatatttccagaaat
gtcctgcagaccagatacaccctgttgccatatctctataccttgatgcataaggcccac
acggagggtgtcactgttgttcggcctctgctccatgagtttgtgtcagaccaggtgaca
tgggacatagacagtcagttccttctgggcccagccttcctggtcagccctgtcctggag
cttaatgccagaaatgtcaccgcatatttccctagagcccgctggtacgattactacacg
ggtgtggatattaatgcaagaggcgagtggaagaccttgcctgcccctcttgaccacatt
aatcttcatgtccgtgggggctatatcctgccctggcaagagcctgcactgaacacccac
ttaagtcgaaagaacgctcttggtcttatcattgccctagatgagaacaaagaagcaaaa
ggagaactcttctgggatgatgggcaaacgaaggtgattggccggcctgtgatggttcct
tactggtctttgggcttccagctgtgtcgctatggataccagaacgactctgagatcgcc
agcttgtatgatgagatggtggccgcccagatcccttatgacgtgcagtactcagacatc
gactacatggagcggcagctggacttcaccctcaaccccaagtttgctgggtttccagct
ctgatcaatcgcatgaaggctgacgggatgcgggtcatcctcattctggatccagccatt
tctggcaatgagacacagccctatcctgccttcactcggggcgtggaggatgacgtcttc
atcaaatacccaaatgatggagacattgtctggggaaaggtctggcctgattttcctgat
gttgttgtgaatgggtctctagactgggacagtcaagtggagctatatcgagcttatgtg
gctttcccagactttttccgtaattcaactgccaagtggtggaagagggaaatagaagaa
ctatacaacaatccacagaatccagagaggagcttgaagtttgatggcatgtggattgat
atgaatgaaccatcaagcttcgtgaatggggcagttcatccaggctgcagggatgcctct
ctgaaccaccctccctacatgcctttcatgcagcaaacactcactaggctcaagggctct
gggaggagaagctctatggcctgtgctccctggctgtaccctcaattcacctccttttcc
cctccaaccagagccgtgcaggaggtgacgggacagcgagggattgtcatcacccgctcc
acatttccgtcttctggccgctgggcaggacattggctgggagacaacacagctgcatgg
gatcagctgaagaaatctatcattggcatgatggagttcagcctctttggcatatcctac
acaggagcagatatctgtgggttctttcaagacgccgaatatgagatgtgtgttcgctgg
atgcagctgggggccttttaccccttctcaagaaaccacaacaccattgggaccaggaga
caagaccctgtatcctgggatgctgctttcgtgaatatttccagaaatgtcctgcagacc
agatacaccctgttgccatatctctataccttgatgcataaggcccacacggagggtgtc
actgttgttcggcctctgctccatgagtttgtgtcagatcaggtgacatgggatatagac
aatcagttccttctgggcccagccttcctggtcagccctgtcctggagctcaatgccaga
aatgtcaccgcatatttccctagagcccgctggtacgattactacacgggtgtggatatt
aatgcaagaggcgagtggaagaccttgcctgcccctcttgaccacattaatcttcatgtc
cgtgggggctacatcctgccctggcaagagcctgcactgaacacccacttaagccgccag
aaattcatgggcttcaaaattgccttggatgatgagggaactgctgagggttggctcttc
tgggatgatgggcaaagcattgatacctatgggaaaggactctattacttggccaagttt
tctgccagccagaatacagtacagagtcatataattttcaacaattacatcactggtaca
aaccctttgaaactgggctacattgaaatctggggagtgggcagtgtccccattaccagt
gtcagcatgtctgtgagcggcatggtcataacaccctccttcaacagtgacggcacggca
caggtgttaagcatcgatgtgaccgacagaaacatcagcctacataatttcacttcattg
acatggagaagcactctgtga

DBGET integrated database retrieval system