KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101054252
Entry
101054252         CDS       T04350                                 

Gene name
CCR3
Definition
(RefSeq) C-C chemokine receptor type 3
  KO
K04178  C-C chemokine receptor type 3
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq04060  Cytokine-cytokine receptor interaction
sbq04061  Viral protein interaction with cytokine and cytokine receptor
sbq04062  Chemokine signaling pathway
sbq05163  Human cytomegalovirus infection
sbq05167  Kaposi sarcoma-associated herpesvirus infection
sbq05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101054252 (CCR3)
   04061 Viral protein interaction with cytokine and cytokine receptor
    101054252 (CCR3)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    101054252 (CCR3)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    101054252 (CCR3)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    101054252 (CCR3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    101054252 (CCR3)
G protein-coupled receptors [BR:sbq04030]
 Rhodopsin family
  Chemokine
   CC Chemokine
    101054252 (CCR3)
Cytokine receptors [BR:sbq04050]
 Chemokine receptors
  CC Chemokine
   101054252 (CCR3)
CD molecules [BR:sbq04090]
 Proteins
  101054252 (CCR3)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx
Other DBs
NCBI-GeneID: 101054252
NCBI-ProteinID: XP_003926306
UniProt: A0A2K6SFL4
LinkDB
Position
Unknown
AA seq 355 aa
MATSLDMVETFGTTPFDYESGELCRKGDIRELIAKFLPLLYSLVFIVGLLGNVLVLVILI
KYKRLRILTNIYLLNLAISDLLFLFTLPFWIHYIMWSDWVFGHGMCKVVSGFYFTGLYGE
IFFIILLTIDRYLAIVHAVFALRARTVTFGVITSIVTWGLAVLAALPEFIFQETENVLQG
SYCNPVYPEDGAQSWKHFYALRVNVLVLALPLLVMAICYAGIIKTLLRCPNKKKYKAIRL
IFVIMVVFFIFWTPYNLALLLYTFQATLFGYDCKQSKDLDLALLVTQVIAYSHCCVNPVI
YAFVGERFRKYLRHFFYRHVLVYLSKYIPFLPSEKLERTSSVSPSTAEPELSIVF
NT seq 1068 nt   +upstreamnt  +downstreamnt
atggcgacctcactagatatggttgagacctttggtaccacgcccttcgactatgaatcg
ggtgagctctgcagaaaaggcgatatcagagagctgattgccaagttcctgcccctgctg
tattccctggtgttcatcgtgggcctcttgggcaatgtgttggtgttggtgatcctcata
aaatacaagaggctccgaattctcaccaatatctacctgctcaacctggccatttccgac
ctgctcttcctcttcacccttccattctggatccactatatcatgtggagtgactgggtt
tttggccatggcatgtgtaaggtcgtctcggggttttatttcacgggcttgtacggagag
atctttttcatcatcctgctgacgatcgacaggtacctggccattgtccatgctgtgttt
gcccttcgagcccgcactgtcacttttggtgtcatcaccagcatcgtcacctggggcctg
gcagtgctagcagctctccctgaatttatcttccaggagaccgaaaacgttcttcaaggg
tcttattgcaaccctgtgtacccagaggatggagcacaaagctggaagcatttctatgct
ctgagagtaaacgtcttggttctcgctctccctctgctcgttatggccatctgctacgca
ggaatcatcaaaacactgctgaggtgccccaataaaaaaaagtacaaggccatccggctc
atttttgtcatcatggtggtgtttttcattttctggacaccctacaacctggctctcctt
ctctatacctttcaagccaccttgtttggatatgactgtaagcagagcaaggatctggac
ctggccctactggtgacacaggtgatcgcctactcccactgctgcgttaacccggtgatc
tacgcctttgttggagagaggttccggaagtacctgcgccacttcttctacaggcacgtg
ctcgtgtacttgagcaaatacatcccattccttcctagtgagaagctggagcgaaccagc
tctgtctctccatccacagcagagccggagctctctattgtgttttag

DBGET integrated database retrieval system