KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101054286
Entry
101054286         CDS       T04350                                 

Gene name
PXN
Definition
(RefSeq) paxillin isoform X1
  KO
K05760  paxillin
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq04062  Chemokine signaling pathway
sbq04370  VEGF signaling pathway
sbq04510  Focal adhesion
sbq04670  Leukocyte transendothelial migration
sbq04810  Regulation of actin cytoskeleton
sbq05100  Bacterial invasion of epithelial cells
sbq05135  Yersinia infection
sbq05163  Human cytomegalovirus infection
sbq05165  Human papillomavirus infection
sbq05170  Human immunodeficiency virus 1 infection
sbq05203  Viral carcinogenesis
sbq05205  Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04370 VEGF signaling pathway
    101054286 (PXN)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101054286 (PXN)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    101054286 (PXN)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    101054286 (PXN)
   04062 Chemokine signaling pathway
    101054286 (PXN)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    101054286 (PXN)
   05203 Viral carcinogenesis
    101054286 (PXN)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    101054286 (PXN)
   05100 Bacterial invasion of epithelial cells
    101054286 (PXN)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    101054286 (PXN)
   05163 Human cytomegalovirus infection
    101054286 (PXN)
   05165 Human papillomavirus infection
    101054286 (PXN)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:sbq04990]
    101054286 (PXN)
Domain-containing proteins not elsewhere classified [BR:sbq04990]
 LIM domain-containing proteins
  Paxillin family proteins
   101054286 (PXN)
SSDB
Motif
Pfam: LIM Paxillin
Other DBs
NCBI-GeneID: 101054286
NCBI-ProteinID: XP_010341119
LinkDB
Position
Unknown
AA seq 1034 aa
MSTSLGSNLSELDRLLLELNAVQHNSPGFPADEANSSPPLPGALSPHYGVPENNSPLGGK
AGPLTKEKPKRNGGRGLEDVRPSVESLLDELESSVPSPVPAITVNQGEMSSPQRVTSSQQ
QTRISASSATRELDELMASLSDFKTSSSTVPLSAPGLLPSPAPSSHSSLPPSPSPPPPMP
SVFLPPTTKPSPRGQGHTPESPCTEQSGRGLLPPVAPSWLDLAGLGVMPGTLNSRSPSVE
GSLGPVGTKSQGRDWRHLPNLTSELSGAPRCHTVPLPGSTGAQEPGEPQSPSASPSCSEE
AVTATWEKPWASEVFKPERIPPCGAAQSFQEVTEPAVVAVDRQAIFPETWTLTKEHGLQQ
EGPRPESGRLRSSCPAPVTREQLGGKMPEKGSMARPTQGPETQRSPEGATEAATQAGKEQ
PQLLCAMATGTPSATERISTSGQIRSVIRRSRETGHAHPMSREPSPRRRLDPATLSRTPS
QERLIAELQGRLGIQPEAEEPAEAAGLSAQDWLTEGVVITVQPRGKRAGGQLVEKVVWRC
PGPGLGQGQAPWVQVLPWPQCWPEGRVGVSCFCELGRLTPLLVQSGKAQGEPGEVTPSPR
AELVISPSLLSLLSSPQVVFPPGSPIPLRRTISVLASPSVPLLQHHTDAEASSSSPLSSL
PTPSSLGPSACICDSSGVRSAGEEHHDEGVQGPTLPTPVPHTVRSVGCQTDEDPLFPPVQ
IQGLEQKADGELCWAAGWPRDSGRSSPGGQDEGGFMTQGKTGSSSPPGGAPKPGSQLDSM
LGSLQSDLNKLGVATVAKGVCGACKKPIAGQVVTAMGKTWHPEHFVCTHCQEEIGSRNFF
ERDGQPYCEKDYHNLFSPRCYYCNGPILDKVVTALDRTWHPEHFFCAQCGAFFGPEGFHE
KDGKAYCRKDYFDMFAPKCGGCARAILENYISALNTLWHPECFVCRECFTPFINGSFFEH
DGQPYCEVHYHERRGSLCSGCQKPITGRCITAMAKKFHPEHFVCAFCLKQLNKGTFKEQN
DKPYCQNCFLKLFC
NT seq 3105 nt   +upstreamnt  +downstreamnt
atgagcacctccttgggcagcaacctttcagagctcgaccgcctgctgctggaactgaat
gccgtgcagcataactcgccaggcttccctgcagatgaggccaactcaagccccccgctt
cctggggccctgagcccccactatggtgtcccagagaataacagcccactggggggcaaa
gctgggcccctgacgaaagagaagcctaagcggaatgggggccggggcctggaggacgtg
cggcccagtgtggagagtctcttggatgaactggagagctccgtgcccagccctgtccct
gccatcactgtgaaccagggagagatgagcagcccgcagcgcgtcacctccagccagcag
cagacacgaatctcggcctcctcggccaccagggagctggacgagctgatggcttcgctg
tcggatttcaagaccagctcctccacagtgcctctgagcgccccggggctgctgcccagc
cctgctccgtcctcacacagctcccttcctccttctccttctcctcctcctcccatgcca
tctgtattcctgccacccaccactaaaccctcccctcgaggccagggccacactccggag
tccccttgtactgagcagagtggacgaggccttctacctcctgtggcccccagctggctt
gatttggctggtcttggggtgatgcctggcaccctcaactcaaggtctccctctgtggag
ggttctctggggccagtgggcacaaagagccagggccgagattggaggcacctgccgaac
ctcacaagtgagctctctggggctcctcgctgccacactgtaccccttcctgggagcaca
ggtgcccaggagcctggggagccccagagcccatcagctagcccttcatgctcagaggag
gcggtgacagccacatgggagaagccatgggcttcggaggtattcaagcctgagagaatc
cccccatgtggagctgctcaaagcttccaagaagtaacagagccagctgttgtggcagtg
gaccggcaggccatcttcccagagacctggactctcacaaaggaacacggcctacagcag
gaggggccgaggccagagtcagggaggctgcgaagcagctgccctgccccagttaccagg
gagcagctaggtggaaagatgcctgagaagggaagcatggccaggcccacccagggacct
gagacccaaaggagcccagagggtgccaccgaagctgccacccaggccgggaaggaacag
ccacagcttctgtgtgccatggccacaggcacacccagcgccacagagaggatttccacc
tctggccagatccgatctgtgatcaggaggagccgggagacgggccatgcacaccccatg
tcccgggagccctcccctcgccgccggctggaccctgccaccctgagcaggaccccatcc
caggaacggctcatcgcggagctgcaggggcggctgggcatccagcctgaggcagaggag
ccagcggaggcagcggggctctctgcccaggactggctgaccgaaggcgtcgtcatcact
gtgcagcctcgtgggaagcgggctggggggcaacttgtagagaaggtggtgtggagatgc
ccagggccggggctgggccagggccaggcaccctgggtccaggttcttccctggccccag
tgctggccagaggggagggtgggggtttcttgcttctgtgaacttggaagactgacccca
ctcttggtgcagagtgggaaggcccagggggagcccggggaggtcactccgtccccgcgg
gctgagctggtgatttccccctcattgctctccctcctttcttctccccaggttgtcttc
cctcctggctctcccattcccttgagaagaaccatctctgtcctggcttctccttctgtc
cctttgctccagcatcacacagacgccgaggccagcagctcttctcccctgtccagcctg
cccactccctcctccctgggaccctcagcttgcatctgtgattcttctggggttcggagt
gcaggggaagagcaccatgatgagggggtgcagggccccacccttcccactcctgtaccc
cataccgtgaggtccgtgggctgccagacggacgaggacccgctcttccccccagtgcag
atccagggcctggagcaaaaagcggatggggagctgtgctgggcggccggctggcctcgg
gacagcgggcggagcagccctggagggcaggatgagggagggttcatgacccaggggaag
acagggagcagttcacctcctgggggggccccgaagcccgggagccagctagacagcatg
ctggggagcctgcagtccgacctgaacaagctgggggttgccacagttgccaaaggagtc
tgcggggcctgcaagaagcccatcgccgggcaggttgtgaccgccatggggaaaacgtgg
caccctgagcacttcgtctgcacccactgccaggaggagattggatcccggaacttcttc
gagcgggatggacagccctactgtgaaaaggactaccacaacctcttctccccgcgctgc
tactactgcaacggccccatcctggataaagtggtgacagcccttgaccggacgtggcac
cctgaacacttcttctgtgcccagtgtggagccttcttcggtcctgaagggtttcacgag
aaggacggcaaggcctactgccgcaaggactacttcgacatgttcgcgcccaagtgtggc
ggctgtgcccgggccatcctggagaactacatctcggccctcaacacgctgtggcatccc
gagtgcttcgtgtgccgggaatgcttcacgccattcatcaacggcagcttcttcgagcac
gacgggcagccctactgtgaggtgcactaccacgagcggcggggctcgctgtgctccggc
tgccagaagcccatcaccggccgctgcatcaccgccatggccaagaagttccaccccgag
cacttcgtctgtgccttctgcctcaagcagctcaacaagggcacctttaaggagcagaac
gacaagccttactgtcagaactgcttcctcaagctcttctgctag

DBGET integrated database retrieval system