KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101054392Help
Entry
101054392         CDS       T04350                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: probable maltase-glucoamylase-like protein
  KO
K12047  maltase-glucoamylase [EC:3.2.1.20 3.2.1.3]
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq00052  Galactose metabolism
sbq00500  Starch and sucrose metabolism
sbq01100  Metabolic pathways
sbq04973  Carbohydrate digestion and absorption
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    101054392
   00500 Starch and sucrose metabolism
    101054392
 09150 Organismal Systems
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    101054392
Enzymes [BR:sbq01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     101054392
    3.2.1.20  alpha-glucosidase
     101054392
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Trefoil Gal_mutarotas_2 DUF5110 GHL15
Motif
Other DBs
NCBI-GeneID: 101054392
NCBI-ProteinID: XP_010338819
LinkDB All DBs
Position
Unknown
AA seq 2459 aa AA seqDB search
MARKLSVLEVLLIVFCLIVVAVDILLLLLVLEEPSDTSFTPECPEIDQSDRIDCTPGQAV
TEDTCRWKYKCCWSPVADANVPACFFPRNWGYEASNGHTNTSTGFTAQLKRLPTPSLFGN
DVATTLFTAEYQTSNRFHFKITDFNNMRYEVSHENIETINSTPNVTNLSYYMEATDKPFS
IKIMRTSNGRVLLDTSIGPLQFAQQYLQLSFRLPSDNVYGLGEHVHQQYLHNMTWKTWPI
FTRDATPTEGMINLYGAHTFFLCLEDTSGSSFGVFLMNSNAMEVTLQPAPAITYRTIGGV
LDFYVFLGNTPEQVVQEYLELVGRPFLPSYWSLGFQLSRRDYGGINNLKEVVSRNRLAEI
PYDVQYSDIDYMDGKKDFTVDEDAYSGLSDFVKELHDNGQKYLIIMNPGIAKDSSYEPYN
NGSIKRVWIMGNNGAAVGEGYPGPTVFPDYSNPECTEWWTDQVLNFHNRLEFDGVWIEMN
EVSSLRQASDQCESNTLNFPPFTPRVLDHLLFARTLCMDTEFNGGLHYDFHSLYGYSMAR
ATDSALKKIFMDKRSFILSRSTFAGSGKFAAHWLGDNAATWDDLRWSIPSILEFNLFGIP
MVGANICGYYNSVTEELCRRWMQLGAFYPLSRNHNGPGFRDQDPAAFGADSLLLNSSRHY
LNIRYTLLPYLYTLFYRAHTRGDTVARPLVHEFYQDSATWELHEQFLWGPGLLITPVLYE
GMDEVKAYIPDATWYDYETRVAIPWRKQFVNMLLPGDKIGLHLRGGYIFPTQKPNTTTEA
SRRNSLGLIIALDYKREANGELYWDNGVSKDSVTGKQYILYDFSVTSNHLQAKILFNNYT
DTYNLMFTDITILGMDKQPANFTVLLNNVTISSPSVVYNSSTKVVTITDLQGLVLGQEFS
IKWNLPVDDLEKFKCYPDDPTASEESCRQQGCLWEHTSTPGVPTCYYDTIPNYVASDIQY
QSTGITANLSFLMASESAAVTASDSLSAKISFLRLSVICHTANMLQVKIYDPTNKRYEVP
VPLNTPPQPDDDPENRLYDVRIQNNPFGIQIQRKTSSTVIWDSQLPGFTFNNTFLSISTR
LPSQYIYGFGETEHTAFRRDMNWNTWGMFARDEPPAYNKNSYGVHPYYMALEEDGSAHGV
LLLNSNAMDVTLQPTPALTYRTTGGILDFYIVLGPTPELVTQQYTELIGRPAMIPYWALG
FQLSRYGYQNDAEISSLYDAMVAAQIPYDVQHVDIDYMDRKLDFTLSASFQNLSLVIEQM
KKNGMRFILILDPAISGNETQYLPFIRGQENDVFIKWPETNDIVWGKVWPDLPNVNVDGS
LDHETQVKLYRAYVAFPDFFRNNTAAWWKKEIEELYTNPREPEKSLKFDGLWIDMNEPSN
FVDGSVWGCRNETLNNLPYVPYLESRDRGLSNKTLCMESQQILPDGSPVQHYNVHSLYGW
SQTRPTYEAVQKVTGQQGVVITRSTFPSSGRWGGHWLGDNRAAWDQLANSIIGMMEFSLF
GIPYTGADICGFFGDAEYEMCVRWMQLGAFYPFSRNHNNIGSRRQDPVAWNSTFEMLSRK
VLETRYTLLPYLYTLMHKAHTEGSTVVRPLLHEFTDDKTTWDIDRQFMLGPAILISPVLE
RSTFEISAYFPKALWYDYSMETSSKSIGEWKILEAPLDHINLHIRGGYILPWQEPAMNTH
SSRQNFMGLIVALDDNGKAEGQMFWDDGQSIDTYENGNYFLANFTAAQNILQIQTIHNKY
LSDSNPLKVGYIRIWGMNSTTYVTQVSFTYDDQQFMERNFQSDPYKQTLTIQLTDKIINL
EKLTNVTWIYGSPVLPTPTKTSTIPTSSHPPPSTTNATSSETITGFASANTTTGTTSTAP
ITTTTFARSTVGVTTSTTVPDTTAPFPTSTTSATVGATTSTTVPDTTAPFPTSTASASTS
VSVPITTTPFATSTVGATTVTTVPDTTAPFPTSTTIASTSVTVPITTTRFATSTVGVTTS
TTVPDTTAPFPTSTTSASSVANVPITTMPSPTNTADANTSNTFSNTTMPSPTSSTTMSTR
ATVSISMTSLLTSTADATISTTVLIATTPSLASTTDVSTNTTIYNISTPLQTSTTNASTT
NVANITTTSYTSTDDTVPITTIPSLANTGVDTSSNSFSIMTTSSSESINATNTTLMVTTS
PASTDVASTNNEASVTNSLLPTMSAGDRTSNSISISTTSSGNIVPIVTTPSPSTDPNSTG
KNTIPGITTYYQTSLTTPTHTLTSIPSSTTPILSMFPTSNTFTTDKITNFTTPRNANTII
FNTLDTKSAMIMDATVATTSTKDNTMSPDTTVTSTDKFTTHITQFTAPHSATTTTLGLSH
TSLAPTNLPSLGTVNITDADNSNTVTGNTTHISVSNITIPSDTITTTGLHLETSHMVTTN
STTEEXWLVIYLLLQTSATTGTANITKYALNTTTPNSTIRTSSTAPTYIANAISATLVP
NT seq 7380 nt NT seq  +upstreamnt  +downstreamnt
atggcgaggaagctcagtgtattggaagtccttctgatcgtcttctgcctaattgtggtg
gccgtagatatcctcttgttgcttcttgtattggaggaaccttcagatacttcatttact
ccagagtgtccagagattgaccaatcggacaggatagactgcacacctggccaggcggtg
acagaggatacctgcagatggaaatataagtgctgctggtcgcctgtggcagatgccaat
gtccctgcctgcttcttccccaggaactggggctatgaagccagcaatggccacacaaat
acaagcacaggatttactgctcagttgaaaaggttgccaaccccatctctgtttggaaat
gatgtcgccaccacccttttcacagctgaatatcagacatccaatcggtttcattttaag
atcactgactttaataacatgcgctatgaagtttcccatgaaaatattgagacaattaat
agcactcctaatgtcaccaatttgagctattacatggaggctactgataaacctttcagc
atcaaaataatgaggacaagcaacggaagagtcttgttggacacgagcattgggcccctc
cagtttgcccagcagtacctgcaactgtctttccgactgcccagtgacaatgtgtatggg
ctgggagagcatgtgcaccagcagtaccttcacaacatgacctggaagacctggcccatc
ttcacccgggatgccacccccactgagggcatgattaatctgtacggagctcatacattc
ttcttatgccttgaagacaccagtggctcctctttcggagtgtttctgatgaacagtaat
gccatggaggttacccttcagccagctcctgcgatcacttaccgcacaattgggggcgtt
cttgatttttatgtattcctaggaaacactccagaacaagtggttcaggaatacttggag
cttgttggacggccattcttgccttcctattggagtcttgggttccagcttagtcgcagg
gattatggtggcatcaataacttgaaagaagttgtaagccgaaatcgtttagctgagata
ccatatgatgtccagtactctgacatagactacatggatggaaagaaggatttcactgtt
gatgaagatgcttactctggtctctcagattttgtcaaggagttacatgacaatggtcag
aaatatctaattattatgaatcctggcatcgccaaagactctagctacgagccttataat
aacggaagcataaaaagagtgtggatcatggggaacaatggcgctgctgttggggaggga
tatccgggacccacagtctttcccgattacagcaatccagagtgcaccgagtggtggaca
gatcaggtccttaactttcataatcgtctggagtttgatggagtgtggattgaaatgaat
gaagtatctagcctgcgtcaagcttctgatcagtgtgaatcaaacaccttgaactttcct
ccttttactcctagagttctggaccacttactatttgcaagaaccctctgcatggacacg
gaatttaacgggggccttcactatgacttccacagcttgtatggctactccatggccaga
gccacagactcagccctgaaaaaaatcttcatggataaaaggagcttcatcttatcccgt
tctacttttgctggatctggcaaatttgctgctcactggctgggggacaatgcagccaca
tgggatgacctccgatggtctatacccagtatccttgagttcaacctgtttggcatcccc
atggtaggtgccaacatctgtggttattacaacagtgtcacagaggagctctgcagaagg
tggatgcagcttggagcgttttatccactatcaaggaatcacaatggacctgggttcagg
gaccaggatcctgctgcctttggtgctgactccctgctgctgaattcctccagacattat
ctgaacatccgctacaccttactgccctatctctacacccttttctaccgtgcacacacc
cggggagacacggtagcgaggccccttgtacatgagttctaccaggactcagccacatgg
gagttgcatgagcagttcttatggggacctggactcctcatcacacctgttttatatgag
ggtatggacgaagtgaaagcatatatacctgatgccacctggtatgactatgagacgcga
gtggccatcccatggaggaaacagtttgtgaatatgctcctcccaggtgataagatagga
cttcatcttcgagggggctacatatttcccacccagaagccaaacacaaccacagaagcc
agcaggaggaattccctcggactcatcattgccttggactataagagagaagccaatggg
gagctgtactgggataatggggtatctaaagattctgtaactggaaagcagtatattcta
tacgatttctctgttacctctaaccatctacaagcaaagattctttttaataattatacg
gacacttacaacctaatgtttacagatatcacaatcttgggaatggacaaacagccagct
aattttactgtcttgttgaataatgtcaccatctccagtccaagcgttgtctataattct
tccacaaaggtggtaaccatcactgatctccaaggactggtactgggacaagaattctct
attaagtggaatcttcctgttgatgacctggagaagttcaagtgctaccctgatgatcca
acagcctctgaggagagttgtaggcagcaggggtgtctttgggagcacacatctactcct
ggcgtgcccacctgttactatgacaccatccctaattatgttgccagtgacattcagtac
cagtccactggcatcactgcaaacctttccttcctgatggcttctgagtcagctgctgtc
accgcctctgattctctctctgcaaagatcagcttcctccgcctgagtgtgatctgtcac
acagcaaacatgctgcaggtcaagatctatgaccccactaataaaagatatgaggtccca
gtgccactgaacacccctccccaaccagatgatgaccctgaaaaccgtctgtatgatgtc
aggattcagaacaatccttttggaatccagattcaacgcaaaacctccagcactgtgatt
tgggattctcaactccccggcttcaccttcaataatacgtttctctccatttctacacgt
ctgccctctcagtacatctatggctttggggaaactgagcacacagctttcagaagagac
atgaactggaacacctgggggatgtttgctcgtgatgagccacctgcgtacaacaagaat
tcctatggggtccacccttactacatggcactggaggaggatggcagtgcccatggagtg
ctcctgctcaatagcaatgctatggatgtgacattacagcccactcctgccttgacatac
cgcaccacaggagggattttggacttttacattgttttggggccaacccctgaacttgta
actcagcaatacacagagttgatcggtcgaccagcaatgattccatactgggccttggga
ttccagctgagtcgctatggataccagaatgatgctgaaatctccagtttatatgatgca
atggtggcagcccagattccctatgacgtccagcatgtagacatcgattacatggaccgg
aagctggattttaccctcagtgccagctttcaaaacctcagtctcgtgattgagcaaatg
aagaaaaatggcatgagatttattctcattttggacccagccatttctggcaatgagacc
caatatctcccattcattagaggacaggaaaatgatgtgttcatcaaatggcctgagacc
aatgacattgtctggggaaaggtttggccagatctgcctaatgtaaatgtagatggatcc
cttgaccatgaaactcaggttaagctatacagggcctacgttgcttttcctgacttcttt
cgtaataacacagctgcatggtggaagaaagagatagaagagctctatacaaaccctcga
gagccagagaagagcttgaagtttgatggattgtggattgatatgaatgagccatcaaac
tttgtggatggatccgtctggggctgcagaaatgaaacactaaataacctaccctatgtg
ccatatttggaatctagggacaggggcctgagcaacaagaccctgtgcatggagagtcag
cagatcctcccagacggctcccccgtgcagcactacaacgtgcacagcctatacgggtgg
tcccagaccagacccacatatgaagctgtgcagaaggtgacaggacagcaaggggttgtc
atcacccgctccacatttccctcttccggacgctggggaggacactggctgggagacaac
agagctgcgtgggaccaactggcgaactctatcattggcatgatggagttcagtctcttt
ggaataccttatacaggagcagatatctgtgggttctttggagatgctgaatatgagatg
tgtgttcgctggatgcaactgggggccttttatccattttccagaaaccacaacaacatc
gggtcaaggagacaagatcctgtggcctggaattcaacctttgagatgttgtccagaaaa
gtcctggagactagatacactctgcttccttatctctatactctgatgcataaagctcac
actgagggcagtactgttgtccggccccttctccatgagtttacggatgataagacaaca
tgggatatagaccgtcagttcatgttgggccctgccatcttaatcagccctgtgttggaa
cgtagcacatttgagatctctgcttattttcccaaagcgctttggtatgactatagcatg
gaaactagcagcaaatcgataggtgagtggaaaattctggaggctcctcttgaccacatc
aaccttcacatcagaggaggctacattctgccctggcaagagcctgcaatgaacactcac
tccagtcgacaaaattttatgggattgattgttgctttggatgacaatgggaaagctgaa
ggccagatgttctgggatgatggacaaagcattgatacctatgaaaatggaaattatttt
ttggcgaactttacagcagctcagaacatcttgcaaatccagaccatacacaataagtat
ttgagtgactcaaatccactaaaagttggatatattagaatctggggtatgaactctact
acctatgtgacacaagtcagtttcacctatgacgaccagcaatttatggagagaaatttc
cagagtgacccttataaacagacactaactattcaattgactgacaagattatcaacctg
gaaaagttaactaatgttacttggatttatggtagtcctgtccttcctactccaactaag
acaagtaccatcccaacgagttctcatcctcctccatctactactaatgctaccagttct
gagactatcactggttttgccagtgcaaatactaccactggcactacttctactgctcct
atcacaaccacaacttttgcaagaagtactgttggtgttacaactagtactactgttcct
gatacaactgctcctttccctacaagtactactagtgctactgttggtgctacaactagt
actactgttcctgatacaactgctcctttccctacaagtactgctagtgctagcactagt
gttagtgttcctatcacaaccacaccttttgcaacaagtactgttggtgctactactgtt
actactgttcctgatacaactgctcctttccctacaagtactactattgctagcactagt
gttactgttcctatcacaaccacacgttttgcaacaagtactgttggtgttacaactagt
actactgttcctgatacaactgctcctttccctacaagtactactagtgctagcagtgtt
gctaatgttcctattacaaccatgccttcccctacaaatactgctgatgctaacactagt
aatactttttctaataccactatgccttctcctacaagtagtactactatgagtaccaga
gctactgtttccatttcaatgacttctcttctgacaagtactgctgatgccaccattagt
actactgtacttattgccactactccttctctagcaagtactactgatgttagcacaaat
actactatttataatataagtactcctcttcaaacaagtactactaatgctagcactact
aatgttgctaatataaccactacctcttatacaagtactgatgatactgttccaattact
actattccttctcttgcaaatactggtgttgatactagtagtaatagtttttctattatg
accacttcttcctctgaaagtattaatgctacaaacactactcttatggtaactacttct
cctgcaagcactgatgttgctagtacaaataatgaagcttctgtgacaaattctctttta
cctacaatgtctgctggtgatagaactagtaatagtatttccatatcaactacttcttct
ggtaatattgttcctattgtgactactccttctccaagtactgatcctaatagtacaggt
aaaaatactattcctggcataactacttattaccaaacttctctcaccactcctacccac
actcttacttctattcctagctctactactcctattttgagcatgtttccaacaagtaat
acatttactactgataaaattactaattttactacccctagaaatgcaaacaccattatt
ttcaacactcttgatacaaaaagtgccatgataatggatgctacagttgctactaccagc
accaaagataataccatgagtccagatacaacagttacttccacagacaaattcactaca
cacatcacacagttcactgctccccattctgctactactacaactctaggcttaagccac
acatcattagctcctacaaatcttcctagtctaggcacagtaaatattactgatgcagat
aactctaacactgtaacaggtaacaccacacacatttctgtttcaaatatcacaataccc
tcagacacaataacaactactggtctacatttagaaacttcccatatggtaacaacaaat
tctactactgaggagtagtggctagttatttacctattactgcaaactagtgctaccaca
ggtactgcaaatattaccaaatatgctttaaatactaccacgcctaatagcacaatacgt
acctctagtactgcacctacttatattgcaaatgccataagtgctactctagttccatga

DBGET integrated database retrieval system