KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101054438
Entry
101054438         CDS       T04350                                 

Gene name
ICAM1
Definition
(RefSeq) intercellular adhesion molecule 1
  KO
K06490  intercellular adhesion molecule 1
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq04064  NF-kappa B signaling pathway
sbq04514  Cell adhesion molecules
sbq04650  Natural killer cell mediated cytotoxicity
sbq04668  TNF signaling pathway
sbq04670  Leukocyte transendothelial migration
sbq04933  AGE-RAGE signaling pathway in diabetic complications
sbq05143  African trypanosomiasis
sbq05144  Malaria
sbq05150  Staphylococcus aureus infection
sbq05164  Influenza A
sbq05166  Human T-cell leukemia virus 1 infection
sbq05167  Kaposi sarcoma-associated herpesvirus infection
sbq05169  Epstein-Barr virus infection
sbq05323  Rheumatoid arthritis
sbq05416  Viral myocarditis
sbq05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    101054438 (ICAM1)
   04668 TNF signaling pathway
    101054438 (ICAM1)
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    101054438 (ICAM1)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    101054438 (ICAM1)
   04670 Leukocyte transendothelial migration
    101054438 (ICAM1)
 09160 Human Diseases
  09163 Immune disease
   05323 Rheumatoid arthritis
    101054438 (ICAM1)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    101054438 (ICAM1)
   05416 Viral myocarditis
    101054438 (ICAM1)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    101054438 (ICAM1)
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    101054438 (ICAM1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101054438 (ICAM1)
   05164 Influenza A
    101054438 (ICAM1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    101054438 (ICAM1)
   05169 Epstein-Barr virus infection
    101054438 (ICAM1)
  09174 Infectious disease: parasitic
   05144 Malaria
    101054438 (ICAM1)
   05143 African trypanosomiasis
    101054438 (ICAM1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sbq04147]
    101054438 (ICAM1)
   04090 CD molecules [BR:sbq04090]
    101054438 (ICAM1)
   00536 Glycosaminoglycan binding proteins [BR:sbq00536]
    101054438 (ICAM1)
   04091 Lectins [BR:sbq04091]
    101054438 (ICAM1)
Exosome [BR:sbq04147]
 Exosomal proteins
  Proteins found in most exosomes
   101054438 (ICAM1)
CD molecules [BR:sbq04090]
 Proteins
  101054438 (ICAM1)
Glycosaminoglycan binding proteins [BR:sbq00536]
 Hyaluronan
  Cell surface receptors
   101054438 (ICAM1)
Lectins [BR:sbq04091]
 I-type lectins (Siglecs)
  101054438 (ICAM1)
SSDB
Motif
Pfam: ICAM_N Ig_2 ig Ig_3 C2-set_2 Adhes-Ig_like
Other DBs
NCBI-GeneID: 101054438
NCBI-ProteinID: XP_003938996
UniProt: A0A2K6SZD4
LinkDB
Position
Unknown
AA seq 535 aa
MAPSGPRPALPALLILLAALLPGPSHAQTSVSPQGIILPRGGSVLVNCSSSCDQRPFLGL
ETPLTKREVLPGGNNWKMFELSNVQENSQPICFSNCGGRQSTAKTFLTVYWTPERVELAP
LPAWQPVGENLTLRCQVEGGAPRANLTVVLLRGEEELSRQPVVGEPAEVTVTVLAGRDDH
GANFSCRTELDLRSQGLELFENTSAPHQLQTFVLPATPPQLLSPRILEVDTQGTVVCSLD
GLFPVSEAQVHLALGDQKLNHTITYGIDSLSAKASVKGTTEDEGTQRLLCAVILGNQSQE
MRKTVTVYSFPAPRVILMEPVVSEGTEVIVKCESDPRAMVMLNGVPAQTLGPGAQLRLKA
RPEDDGRNFSCSTTLEVAGQVVHKNQTLELRVLYGPKLDEKDCPRNWTWPENSQQTPICQ
AWGNPSPQLECLKDGTLPLPIGKSVTVTRDLAGTYLCRATSTQGEVTSEVIVNVVTVPSP
RHEMVIMAIVLTAAILGTAGVAMYLYNRQRKIRKYRLQQAQNRTPMKPITQATPP
NT seq 1608 nt   +upstreamnt  +downstreamnt
atggctcccagcggcccccggccagcgctgcctgccctcctgatcctgctcgcggctctg
ctcccaggacctagccatgcccagacgtctgtatccccccaagggatcatcctgccccgg
ggtggatccgtgctagtgaactgcagcagctcctgtgatcagaggcccttcttgggcctg
gagactccgctgactaaaagggaggtgctcccaggtgggaacaactggaagatgtttgaa
ctgagcaatgtgcaagaaaacagccagccaatatgcttttcaaactgcggtggtagacag
tcgacagcgaaaaccttcctcaccgtgtactggactccagaacgggtggagctggcaccc
ctccctgcttggcagccggtgggcgagaaccttaccctacgctgccaggtggagggcggg
gcaccccgggccaacctcaccgtggtgctgctccgtggggaagaggagctgagccggcag
ccggtggtgggggagcctgctgaggtcacggtcacggtgctggcaggcagagatgatcac
ggagccaatttctcgtgccgcactgaattggacctgcggtcccaagggctggagctgttc
gagaacacttcggccccccaccagctccaaacctttgtcctgccagcaactcccccacaa
cttctcagcccccggatcctggaggtagacacgcaggggacggtggtctgttccctggat
gggctgttcccagtctcggaggcccaggtccacctggcgctgggggaccagaagctgaac
cacacaatcacctatggcatcgactccctctcggccaaggcctcggtcaaggggaccaca
gaggatgagggcacccagcggctgttgtgtgcagtaatacttgggaatcagagccaggag
atgcggaagacagtgaccgtctacagctttccggcacccagagtgattctgatggagcct
gtggtctcagaaggaaccgaggtgatcgtgaagtgtgagtccgaccccagagccatggtg
atgctgaatggggtcccagcccagacactgggcccgggggcccaattacggctgaaggcc
aggcccgaggacgatggacggaacttctcctgctctacaaccctagaggtggctggacag
gtcgtacacaagaaccagaccctggagctccgtgtgctgtatggccccaaactggacgag
aaggattgtccgagaaactggacgtggccagaaaactcccagcagactccgatatgccag
gcttggggaaatccctcaccccagcttgagtgtctaaaagatggcactttgccactgccc
atcgggaaatcagtgactgtcacacgggatcttgcgggaacctacctctgtcgggctacg
agcactcagggggaggtcacctccgaggtgatcgtgaacgtggtgaccgtgccctccccc
cggcatgagatggtcatcatggccatagtgctgactgcagccatcctgggcactgcaggc
gtcgccatgtacctctataaccgccagaggaagatcaggaaatacagactccaacaggct
caaaacaggacccccatgaaacccatcacacaagccacgcctccctga

DBGET integrated database retrieval system