KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101054503
Entry
101054503         CDS       T04350                                 

Gene name
RASSF5
Definition
(RefSeq) ras association domain-containing protein 5 isoform X1
  KO
K08015  Ras association domain-containing protein 5
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq04014  Ras signaling pathway
sbq04015  Rap1 signaling pathway
sbq04218  Cellular senescence
sbq04670  Leukocyte transendothelial migration
sbq05200  Pathways in cancer
sbq05223  Non-small cell lung cancer
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    101054503 (RASSF5)
   04015 Rap1 signaling pathway
    101054503 (RASSF5)
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    101054503 (RASSF5)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    101054503 (RASSF5)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101054503 (RASSF5)
  09162 Cancer: specific types
   05223 Non-small cell lung cancer
    101054503 (RASSF5)
SSDB
Motif
Pfam: Nore1-SARAH RA C1_1 C1_2 PHD
Other DBs
NCBI-GeneID: 101054503
NCBI-ProteinID: XP_003930489
UniProt: A0A2K6T0A0
LinkDB
Position
Unknown
AA seq 418 aa
MAMASPAVGQRPYRLLLDPEPPRYLQTLSGPEPPPPPHDRSSLRCVPAPLSTAPGAHEGR
SARRAARGNLEPPSRAPRPARPLRPGLQQRLRRRPGAPRPRDVRSIFEQPQDPRVPAERG
EGHRFAELVLPVGPGWCDLCGREVLRQALRCANCKFTCHPECRSLIQLDCSQQEGSFRDR
SSPESTLTLTFSQNVCKPVEETQRPPTLQEIKQKIDSYNTREKNCLGMKLSEDGTYTGFI
KVHLKLRRPVTVPAGIRPQSIYDAIKEVNLAAATDKRTSFYLPLDAVKQLHISSTTTVSE
VIQGLLKKFMVVDNPQKFALFKRIHKDGQVLFQKLSIADCPLYLRLLAGPDTEVLSFVLK
ENETGEVEWDAFSIPELQNFLTILEKEEQDKIQQVQKKYDKFRQKLEEALRESQGKPG
NT seq 1257 nt   +upstreamnt  +downstreamnt
atggccatggcgtccccggctgtcgggcagcgcccgtaccggttactcttggatcccgag
ccgccgcgctacctgcagaccctgagcggcccggagccgccgccgccgccccacgaccgg
tcctcgctccgctgtgtcccggcgcccctctccactgcgcccggggcgcatgaggggcgc
agtgcccggagggctgcccgggggaatctggagcccccatcccgggctccccgacctgct
cgcccgctccggcctggactgcagcagagactgcggcggcgccctggagcgccccgaccc
cgcgacgtgcggagcatcttcgagcagcctcaggatccccgcgtcccggctgagcgaggc
gaggggcaccgcttcgcggaattggtgctgccggtcggccccggctggtgtgacctgtgc
ggacgagaggtgctgcggcaggcgctgcgctgcgctaactgtaaattcacctgtcaccca
gagtgccgcagcctgatccagctggactgcagtcagcaggagggttcattccgggacaga
tcctctccagaaagcacccttaccctgaccttcagccagaatgtctgtaaacctgtggag
gagacacagcgtccacccacactgcaggagatcaagcagaagatcgacagctacaacacg
agagagaagaactgcctgggcatgaagctgagtgaagacggcacctacacgggtttcatc
aaagtgcatctgaagctccggcggcctgtgacggtgcctgccgggatccggccccagtcc
atctatgacgccatcaaggaggtgaacctggcggccgctacggacaagaggacatccttc
taccttcccctcgatgccgtcaagcagctgcacatcagcagcaccaccaccgtcagtgag
gtcatccaggggctgctcaagaagttcatggtcgtggacaatccccagaagtttgcactt
tttaagcggatacacaaggatggacaagttctcttccagaaactctccattgctgactgc
cccctctacctgcgcctgctcgctgggcctgacacggaggtcctcagctttgtgctaaag
gagaatgaaactggagaggtggagtgggatgccttctccatccctgaacttcagaacttc
ctaacaatcctggaaaaagaggagcaggacaaaatccaacaagtgcaaaagaaatatgac
aagtttaggcagaaactggaggaggccttaagagaatcccagggcaaacctgggtaa

DBGET integrated database retrieval system