KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 104651216
Entry
104651216         CDS       T04350                                 

Gene name
VHL
Definition
(RefSeq) LOW QUALITY PROTEIN: von Hippel-Lindau disease tumor suppressor
  KO
K03871  von Hippel-Lindau disease tumor supressor
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq04066  HIF-1 signaling pathway
sbq04120  Ubiquitin mediated proteolysis
sbq05200  Pathways in cancer
sbq05211  Renal cell carcinoma
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    104651216 (VHL)
 09130 Environmental Information Processing
  09132 Signal transduction
   04066 HIF-1 signaling pathway
    104651216 (VHL)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    104651216 (VHL)
  09162 Cancer: specific types
   05211 Renal cell carcinoma
    104651216 (VHL)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:sbq04121]
    104651216 (VHL)
Ubiquitin system [BR:sbq04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   ECV complex
    Target recognizing subunit (VHL box)
     104651216 (VHL)
SSDB
Motif
Pfam: VHL VHL_C Arm_vescicular
Other DBs
NCBI-GeneID: 104651216
NCBI-ProteinID: XP_010336089
LinkDB
Position
Unknown
AA seq 200 aa
MPRRAENRDXAEVGAEESGASESGPEESIPEGPGAEKEMEAGRPRPVLRSVNSREPSQVI
FCNRSPRVVLPVWLNFDGEPQPYPTLPPGTGRRIHSYRGHLWLFRDAGTHDGLLVNQTEL
FVPSLNVDGQPIFANITLPVYTLKERCLQVVRSLVKPENYRRLDIVRSLYEDLEDHPNVQ
KDLERLTQEHIANQQMAAEI
NT seq 603 nt   +upstreamnt  +downstreamnt
atgccccggagggcggagaaccgggactaggccgaggtaggggcggaggagtcgggcgcc
tcggagtccggcccggaagagtccatcccggaggggccgggcgctgagaaggagatggag
gccgggcggccgcggccggtgctgcgctcggtgaactcgcgcgagccctcccaggtcatc
ttctgcaaccgcagcccgcgcgtcgtgctgcccgtgtggctcaacttcgacggcgagccg
cagccctaccccacgctgccgccgggcacgggccgccgcatccacagctaccgaggtcac
ctttggctcttcagagatgcagggacacacgatgggctactggttaaccaaactgaatta
tttgtgccatctcttaatgttgacggacagcctatttttgccaatatcacactgccagtg
tatactctgaaagagcgatgcctccaggttgtccggagcctagtcaagcctgagaattac
aggagactggacatcgtcaggtcgctctacgaagatctggaagaccacccaaatgtgcag
aaagacctggaacggctgacgcaggagcacattgcaaatcaacagatggcagcggagatt
taa

DBGET integrated database retrieval system