KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 104651817
Entry
104651817         CDS       T04350                                 

Definition
(RefSeq) whey acidic protein-like
  KO
K17106  whey acidic protein
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq04917  Prolactin signaling pathway
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09150 Organismal Systems
  09152 Endocrine system
   04917 Prolactin signaling pathway
    104651817
SSDB
Motif
Pfam: WAP Conotoxin_I2
Other DBs
NCBI-GeneID: 104651817
NCBI-ProteinID: XP_010339672
UniProt: A0A2K6S3Y9
LinkDB
Position
Unknown
AA seq 131 aa
MRCLLSLALALLVLEVTLAVVPAFISPEQAVCPEASSSEEAPCVKTCLTDNDCLGNNKCC
PSACGRSCKTPTIVLTPKVGSCPWVQPPVSPELCQEQSECSMDSQCWGNKKCCFSRCARK
CLDPILEDVPQ
NT seq 396 nt   +upstreamnt  +downstreamnt
atgcgctgcctcctcagcctggccctagccttgcttgtgctggaagtgaccctcgctgtg
gtcccagccttcatctcgccagagcaggccgtgtgccctgaggccagctcctctgaggag
gcgccctgcgtcaaaacctgcctcaccgacaacgactgtcttggcaacaacaagtgttgc
cccagcgcctgtggccgctcctgcaaaacccccaccatcgtattgactccaaaggttggc
agctgcccctgggtacagcccccagtgagcccagagctctgccaagagcagagtgagtgc
tccatggacagccagtgttggggaaacaagaagtgctgcttcagccgctgtgccaggaag
tgtctggaccctatcctagaggacgtccctcagtga

DBGET integrated database retrieval system