KEGG   Shewanella baltica OS117: Sbal117_0944Help
Entry
Sbal117_0944      CDS       T02013                                 

Definition
(GenBank) alkyl hydroperoxide reductase, F subunit
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
sbs  Shewanella baltica OS117
Brite
KEGG Orthology (KO) [BR:sbs00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Sbal117_0944
Enzymes [BR:sbs01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     Sbal117_0944
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox Thioredoxin_3 FAD_binding_2 GIDA HI0933_like FAD_oxidored DAO NAD_binding_7 Thi4 Glutaredoxin AlaDh_PNT_C FAD_binding_3 NAD_binding_8 FMO-like K_oxygenase
Motif
Other DBs
NCBI-ProteinID: AEH12723
LinkDB All DBs
Position
complement(1059969..1061555)
Genome map
AA seq 528 aa AA seqDB search
MLDANLKNQLQTYLQNLKRPVELVVSADESKKSQELKSLAQDIVSLSSLVSLKETQGERT
PAMTVINPQLNTQISFAGLPMGHEFTSLVLALLHTGGHPIKLSDDIIEQIRNLPGKYAFE
TYVSLTCQNCPDVVQALNMMAAINPNITNVMIDGALFQDEVASRNIMAVPSVYLNGEVFA
AGRISIGEILNKLDTNTASRKADEINEKAPFEVLVVGGGPAGAAAAIYAARKGLRTGIVA
DKFGGQVAETVGIENFISVKATEGPKLVANLEAHVRDYEVDIMDNQKAVSLSTDGLFELE
LASGAKLRSRTVLLATGARWREMNVPGEKEYRGKGVAYCPHCDGPLFKGKRVAVIGGGNS
GIEAAIDLANIVEHVTVLEFDKTLRADDVLQRKAASMGNIKIITQAMTTEVTGDGTRVNG
LNYTDRATGESHNVALAGIFVQIGLVPNTEWLKGVVELTPRGEIVVDTRGQTSIPGVFAA
GDVTDTPFKQIIIAMGSGASASLGAFDYLIRHSDEEIAETKTTDTKAA
NT seq 1587 nt NT seq  +upstreamnt  +downstreamnt
atgttagatgcgaatttaaaaaatcaactgcaaacctatctgcaaaacctcaagagacca
gttgaacttgtcgtgtctgcagatgagagcaaaaagtctcaagaattaaaaagcttagcg
caagacattgtcagcctatcttctctggtgagcctgaaagaaactcagggcgaacgcacc
cctgcgatgacagtgataaacccacaacttaacacgcaaatcagctttgctggtctgcct
atgggtcacgaatttacctcacttgtgttggccttactgcacacgggtggacacccaatc
aaactcagcgatgacattatcgagcagatccgcaatctgccgggcaaatatgcctttgaa
acttacgtctcactgacctgccaaaactgcccagacgtagtacaggcactgaacatgatg
gcggcgattaacccgaatatcaccaacgtgatgatcgacggcgccctattccaagacgaa
gtggcgagccgtaacattatggccgtgccttctgtctacttaaatggcgaagtatttgca
gccggtcgtatcagcattggcgagatcctcaataaactggacaccaataccgcaagccgc
aaggccgatgaaattaatgaaaaagcgccattcgaagtcttagtggtgggcggcggccca
gcgggcgcagcagcagctatttatgcagcacgtaaaggccttcgcactggtattgttgcc
gataagtttggcggccaagtggctgaaaccgttggtatcgagaactttatttcggtcaaa
gcgaccgaaggtcccaagctagtggcaaaccttgaagcccatgtacgagactacgaagtc
gacatcatggacaaccaaaaggcagtgtcgttatcaacagatggcttgttcgagcttgaa
ctggcaagcggcgctaaattacgaagccgcactgtattgttagccacaggggcacgctgg
cgtgaaatgaatgtccccggcgagaaagaataccgtggtaaaggtgtcgcatactgtccg
cattgcgatggcccgttatttaaaggcaagcgtgtggcggtgattggcggcggtaactca
ggtatcgaagcggctatcgatctcgccaacatagtagaacatgtgactgtgctggagttt
gataaaaccctacgcgccgacgatgtgctacaacgtaaagcagcgtctatgggtaacatc
aagattattacccaagccatgaccacagaagtgactggcgatggtactcgggttaatggc
ctaaactacacagacagagcaacaggcgagagtcacaatgtcgcacttgcaggtatcttc
gtgcaaattgggctagtaccgaataccgagtggctaaaaggtgtggttgaactgacgcca
cgtggggaaatcgttgtcgatacccgcggtcaaacatccatcccaggagtatttgcggca
ggcgatgtcactgacacgccgtttaagcaaattatcatcgccatgggcagcggcgcgagt
gcatcactgggcgcatttgattacttaattcgtcacagcgatgaagaaatcgccgagacg
aaaaccacagatacgaaagcggcctaa

DBGET integrated database retrieval system