KEGG   Shewanella baltica OS117: Sbal117_0963Help
Entry
Sbal117_0963      CDS       T02013                                 

Definition
(GenBank) Glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
sbs  Shewanella baltica OS117
Pathway
sbs00564  Glycerophospholipid metabolism
sbs01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sbs00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    Sbal117_0963
Enzymes [BR:sbs01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     Sbal117_0963
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO NAD_binding_8 FAD_oxidored Pyr_redox_2 FAD_binding_2 FAD_binding_3 3HCDH_N HI0933_like Pyr_redox GIDA Pyr_redox_3
Motif
Other DBs
NCBI-ProteinID: AEH12742
LinkDB All DBs
Position
1080529..1081704
Genome map
AA seq 391 aa AA seqDB search
MASFDIAIIGGGISGVGIAQYAVAAGYSTLLIEKGEIGGQTSANSSKLIHGGLRYLETGQ
INLVRKSLLERRHLLNLAPTLVKAVPFYIPVYDNSQRSPWTIRAGLSMYALLSEFDPLGQ
FVSVPAVHWHRFKGLKLNGLKAVFQYWDAQTDDKLLTQAVARSAQALGAEVYAEAEFLEL
EHRRETCELSFSHRGEIHKAEASLVINAAGPWVNAVLSKVLPPLAGVELDCVQGAHVLLD
IPAPDGILYLESCFDKRVIFVMPWYGQTLVGTTETELASLDKPPEATESEINYLLGIYKH
YFPLTPEIDELKTKITQTFCGIRVLPKQNSQAFERPRDTLMKTSISHPRILSLYGGKLTT
FRSTSAEVLEWIEKALGKREAIADVDKLSLS
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atggccagtttcgatatagccattattggcggtgggatcagcggtgtcggcattgcccaa
tatgcggtagcggcgggctattctaccttgctgattgaaaagggcgaaattggcggccaa
acctcagctaattccagcaagcttatccatggcggcttgcgctatttagaaacggggcaa
atcaatttagtccgtaagtccttgcttgaacggcgccatttactcaatctagcgcccact
ctggttaaagctgtgcctttttatattccagtgtatgacaacagtcagcgcagtccctgg
actattcgcgcgggcttaagcatgtatgcgctgctgagtgagtttgatcccttgggccaa
tttgtgtcagtgcctgccgtgcattggcatcgttttaaaggattgaaactcaatggatta
aaggcggtgtttcagtattgggatgcgcagaccgacgataagttgttaactcaagcggtg
gcgcgcagcgcgcaggcattgggcgccgaagtctatgccgaggctgaatttcttgagctg
gaacataggcgcgaaacttgtgagctaagttttagccacaggggcgaaatccataaagcc
gaggcgagtctagtcatcaatgctgccggcccttgggtgaatgcggttttaagcaaagtc
ttgcctccacttgcgggtgttgaactcgattgtgtgcaaggcgcccatgtgctactggat
attcctgcgcccgatggcatcttgtatttagagtcttgcttcgataagcgggtcatattt
gtgatgccttggtatgggcaaaccttggttggcaccacagaaacggaactggcttctttg
gataaaccacccgaagcgaccgagtctgaaattaattatctgcttggtatttataagcat
tacttcccgctaacgccggagattgatgagcttaagacaaagataacccagaccttctgc
ggcattcgggttttacctaagcaaaatagccaagcctttgagcggccgcgggatactttg
atgaaaacatcgatttcccatccgcgcatcctcagtttatacggcggtaagttaacgacg
tttcgcagcacctcggcagaagtacttgaatggattgaaaaggcccttggtaagcgcgag
gcgattgccgatgttgataagctcagcttgtcttga

DBGET integrated database retrieval system