KEGG   Shewanella baltica OS117: Sbal117_1630Help
Entry
Sbal117_1630      CDS       T02013                                 

Definition
(GenBank) Sulfate-transporting ATPase
  KO
K01990  ABC-2 type transport system ATP-binding protein
Organism
sbs  Shewanella baltica OS117
Brite
KEGG Orthology (KO) [BR:sbs00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:sbs02000]
    Sbal117_1630
Transporters [BR:sbs02000]
 ABC Transporters, Prokaryotic Type
  ABC-2 type and other transporters
   ABC-2 type transporter
    Sbal117_1630
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 SMC_N SbcCD_C DUF4162 CysG_dimeriser AAA_23 Mg_chelatase Rad17 AAA_22 AAA PALP AAA_29
Motif
Other DBs
NCBI-ProteinID: AEH13386
LinkDB All DBs
Position
1872462..1873418
Genome map
AA seq 318 aa AA seqDB search
MSHADFAIETQGMTRAFGGVNAVENLDLAIPKGTIYGFLGPNGCGKSTSIRMLTGLLSPT
SGEIRVLGETLPGAEEKLRRRIGYMTQKFSLYDNLSVRENLEFVAQIYGLNRRASKLRIA
ELVTLYDLVGREKQMAGSMSGGQKQRLALAAATLHHPELLFLDEPTSAVDPENRREFWER
LFDLCAQGTTILVSTHYMDEAERCHGLAILERGIKRADGSPQQLMAAMGARVVEVSGDDL
RNLKQSLISESAVLSAAQIGSRLRVLVRSDIEDPLAWLKPRVASRTMEEVRASLEDVFVT
CTGERLAGVSKGETDHVA
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
atgagccacgccgattttgctatcgagacccaaggcatgacccgcgcctttggcggcgtc
aatgcggtggaaaacctcgacctcgccattcccaagggaaccatttatggatttcttggc
cccaatggctgcggaaaatccacttcaattcgcatgttgactgggctgctgagcccaacg
tcgggggaaatccgcgtcttgggtgaaaccttacccggcgccgaggaaaaactgcgtcgc
cgcatcggctatatgacgcaaaaattctccctgtacgacaatctttcggtgcgggaaaac
ttagaatttgtcgcgcaaatctatggtttgaaccgccgagcctcaaagctgcggatagcc
gagttagttacgctgtacgatttagtcggccgcgagaaacaaatggcgggctccatgagt
ggcggccagaaacagcgtttggccttagcggcggcgaccttgcatcaccccgaattgctg
tttctcgatgagccgacctcggcggtcgatcccgagaatcggcgcgagttttgggagcgc
ttattcgatctctgcgcccaaggcaccacgattcttgtgtcgactcactatatggatgaa
gccgagcgttgccacggtctggcgattttagagcgggggataaaacgcgccgacggttca
ccccagcagctgatggcggcgatgggcgctcgggtggttgaagtttcaggggatgattta
cgcaatttaaagcaatcattgatcagcgagtctgccgtattatcggcggcgcaaatcggc
agtcgtttgcgggtgttagtgcgcagcgatattgaagatccgctcgcttggcttaaacct
cgggttgccagccggacgatggaagaagtgcgcgctagcctagaggatgtgtttgtcact
tgcaccggcgagcgtttggctggggtgtccaagggagaaactgatcatgtggcgtag

DBGET integrated database retrieval system