KEGG   Shewanella baltica OS117: Sbal117_1683Help
Entry
Sbal117_1683      CDS       T02013                                 

Definition
(GenBank) Diaminobutyrate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
sbs  Shewanella baltica OS117
Pathway
sbs00250  Alanine, aspartate and glutamate metabolism
sbs00410  beta-Alanine metabolism
sbs00430  Taurine and hypotaurine metabolism
sbs00650  Butanoate metabolism
sbs01100  Metabolic pathways
sbs01110  Biosynthesis of secondary metabolites
sbs01120  Microbial metabolism in diverse environments
sbs02024  Quorum sensing
Module
sbs_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:sbs00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    Sbal117_1683
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Sbal117_1683
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Sbal117_1683
   00430 Taurine and hypotaurine metabolism
    Sbal117_1683
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    Sbal117_1683
Enzymes [BR:sbs01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     Sbal117_1683
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC Beta_elim_lyase Aminotran_5 LmjF365940-deam P53_tetramer
Motif
Other DBs
NCBI-ProteinID: AEH13437
LinkDB All DBs
Position
complement(1932383..1934032)
Genome map
AA seq 549 aa AA seqDB search
MTQKLPRQATASEESLLRIFTAPEDAGSTLSIIEQKLSEDLAGFLGDSIAALEKPLSEIE
TDFQAFEIPTQPRFVSDYTDEIMQNLVAHSVHTAAPSFIGHMTSALPYFVLPLSKMMVGL
NQNLVKIETSKAFTPLERQVLGMMHHLIYDQDTDFYQSWMHSANHSLGAFCSGGTVANIT
ALWIARNQLLKADGEFKGVSREGLLKALRHYGYDDLAILVSERGHYSLGKAVDLLGIGRD
NIISIPTGSDNKVDVAKMRQAALELARKNIKVLAIVGVAGTTETGNVDPLTELAALAKEL
NCHFHVDAAWGGASLLSNKYRHLLAGIELADSVTIDAHKQMYVPMGAGMVLFKDPEFAHA
IAHHAEYILRRGSKDLGSQTLEGSRPGMAMLVHACLQIIGRDGYEILINNSLEKARYFAE
QIKAHEDFELVTEPELCLLTYRYVPARVQAAMKLACEQADTIRVARFNELLDGLTQFIQK
HQREQGKSFVSRTRIQPARYFRQATVVFRVVLANPLTSHDILNQVLIEQSEIAALDNEFL
PALMAMVAQ
NT seq 1650 nt NT seq  +upstreamnt  +downstreamnt
atgacccagaaactccctcgccaagccacagcatccgaagaaagtctgctccgcattttt
actgcaccggaagatgcaggatcaacgctgagtattatcgagcagaagctctccgaggac
ttagcaggctttttgggtgacagtatcgccgcgctcgaaaaacccttgtcggaaattgaa
accgattttcaagcctttgagatcccaactcagccgcgttttgtttccgattacaccgac
gaaattatgcaaaatctggtggcgcattcggtacacacagcggcaccaagttttatcggc
cacatgacgtcggcactgccctactttgtgttgccgctgtcgaaaatgatggtgggactc
aatcaaaatctggtcaaaatcgaaacctcaaaggcatttacgccgcttgagcgccaagtg
ctcggcatgatgcaccatttgatttacgaccaagatactgatttttatcaaagctggatg
cacagcgccaatcattccctcggagcattttgctccggcggcacggttgccaacatcacc
gccctgtggattgcccgtaaccaattattgaaagccgatggtgagtttaaaggcgtcagc
cgcgaaggcttactcaaggcactgcgccactatggctatgacgatttagcgattttggtc
tccgagcgaggtcactattcgcttggcaaagccgtcgatctgcttggtatcggccgcgac
aatatcatcagcattcccacaggcagcgataacaaggtcgatgtcgcgaaaatgcgccaa
gccgcccttgaacttgcccgtaaaaacatcaaggtgttggcgattgttggtgtggctggc
accactgaaaccggtaatgttgacccactgacagagttagcggcgctcgcaaaagagtta
aattgccatttccatgtggatgcggcgtggggcggcgcaagtttattatccaataaatac
cgccacttactcgctggtatcgaacttgccgattcagtcaccatcgatgcccacaaacaa
atgtacgtgcctatgggcgcgggcatggtgttatttaaagatccagagtttgcccacgcc
attgcccatcacgccgaatatattttgcgacgtggttcaaaggacttaggcagccaaacg
ctggaaggttcacgccccggcatggcgatgttagtgcacgcttgcttacagatcatcggc
cgcgatgggtatgaaatattaattaacaacagccttgaaaaagcgcgctattttgcagag
caaatcaaagcccatgaggattttgagctcgtcactgaaccagaactgtgtctgctgact
tatcgttatgtccccgcccgcgtacaagccgccatgaagctggcctgtgagcaagcagac
acgataagagtcgcccgctttaacgagttgctcgatggcctcactcagtttattcaaaag
caccaacgcgaacagggtaaatccttcgtctcccgcacccgcattcagcctgcccgctac
tttaggcaagcgactgtggtgtttcgcgtagtactcgccaaccccctcaccagccatgac
attctcaatcaagtgctaatcgagcaaagtgaaatcgccgcactagataacgagttttta
cccgcactcatggcgatggttgcccaatag

DBGET integrated database retrieval system