KEGG   Shewanella baltica OS117: Sbal117_2168Help
Entry
Sbal117_2168      CDS       T02013                                 

Definition
(GenBank) D-alanyl-D-alanine carboxypeptidase/D-alanyl-D-alanine-endopeptidase
  KO
K07259  serine-type D-Ala-D-Ala carboxypeptidase/endopeptidase (penicillin-binding protein 4) [EC:3.4.16.4 3.4.21.-]
Organism
sbs  Shewanella baltica OS117
Pathway
sbs00550  Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:sbs00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Sbal117_2168
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:sbs01002]
    Sbal117_2168
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:sbs01011]
    Sbal117_2168
Enzymes [BR:sbs01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     Sbal117_2168
   3.4.21  Serine endopeptidases
    3.4.21.-  
     Sbal117_2168
Peptidases [BR:sbs01002]
 Serine Peptidases
  Family S13: D-Ala-D-Ala peptidase C family
   Sbal117_2168
Peptidoglycan biosynthesis and degradation proteins [BR:sbs01011]
 Peptidoglycan biosynthesis and degradation
  DD-Carboxypeptidase/DD-Endopeptidase (Low molecular weight PBP)
   Sbal117_2168
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_S13 Beta-lactamase2 Peptidase_S11
Motif
Other DBs
NCBI-ProteinID: AEH13900
LinkDB All DBs
Position
complement(2478163..2479671)
Genome map
AA seq 502 aa AA seqDB search
METLLKTTLYASLLLAASHNIARAEQIDAGAIETRTTSLSQAVSKISPRHSQIALLAMDM
SNNQVIFSQQAETLFIPASTQKLLTAVSAMAQLGPDFRYVTELWTDAPIRKGHIAGSAYL
RFSGDPTFTQADLKAIFASLVKQGINRIDGHLYLLGDKQEQMQAPGWVWDDLGICFAAPV
SSYIINQNCVYGQFNPSTANKPSQVSLRTGSYGVKVSSDAVFDPKASREFCQLDLVRLGQ
NNYHLRGCYPGGEAIGLAIAVSDPFKFAQDNLTSLLKGEMSLAGKVKLGTSLPKKAKLIA
SHSSSPLPELLDTMLLKSDNLIADSLFKQLGKSYFNAQGSFTNGAVAMQRILTELGVDLS
NANIVDGSGLSRYNLLNAQQLAAVLALIHKDSRFSSLMTSLPQAGISGTLRYRMGYNKPP
LKQQIFAKTGSMQGVSNLAGFIRLPEHSDTLFVVLENGMSPELKHQHKPSFNAEFLKQLI
SVLQVPSPTTAALSTAAHSVQD
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
atggaaacgttactgaaaaccactctgtatgccagcctactcctagcggcgagccacaat
atcgcccgcgctgagcaaatcgacgcaggagcgatagagactcgaaccacttcgcttagc
caagcggtcagcaaaatcagccctcggcactcgcaaattgcactgctggcaatggacatg
tctaacaatcaagtgatctttagccaacaggccgagacgctgtttattcccgccagcacg
caaaaactactcactgctgtgagcgccatggctcaacttgggcctgattttcgttatgtc
actgaattatggacggacgcaccaatacgcaagggccatatcgccggcagcgcttatctg
cgttttagtggcgatccgacgttcactcaagccgatctcaaggccatttttgccagtctc
gtgaaacaaggcattaatcgtattgatggacatctgtatttgctcggcgataaacaagag
caaatgcaagcccctggttgggtgtgggatgacttaggcatttgttttgctgcgcctgtg
tcgagttacattatcaatcaaaactgcgtctatggtcagttcaaccccagcacggccaat
aaaccatcgcaggtgagcctgcgcacggggagttatggggtaaaagtcagcagcgatgcg
gtatttgatcccaaggcgagtcgtgaattttgccagctcgatttggtgcgactaggccaa
aacaactatcatctacgtggttgttatccgggcggtgaagcgattgggctggcgattgcg
gtcagcgatccgttcaaatttgcccaagataacctcacctcgctgctcaaaggcgagatg
tcactcgcgggtaaagttaagctcggcacaagcttgcccaaaaaggcgaaattgattgcc
agccatagctcgtcgcctctgcctgaattgctcgatactatgctgctcaagtcggataat
ttgattgctgatagcctgtttaaacagcttggcaaaagttatttcaatgcccaaggtagc
tttaccaatggcgcggtagccatgcaacggattttaacggagttaggcgtcgatctgagt
aacgctaacattgtcgatggttcagggctgtcacgctataacttgctcaatgcccagcag
ttagcggcggtattggcactcatccataaggacagccgctttagctcgttaatgaccagt
ctgccgcaagcaggaataagcggcaccttaaggtatcgcatgggttacaacaagccgccg
ctgaaacagcaaatttttgctaaaacaggctcgatgcaaggcgtgtctaacttagcgggg
tttatccgtttgcctgagcacagtgacaccctgtttgtggtgcttgagaatggcatgagt
cccgagcttaaacatcagcataaaccatcgtttaatgccgagtttctcaagcaattgatt
tcagtgctgcaagtgccatcccccaccacagcagcgcttagtaccgctgctcactcggtc
caagattaa

DBGET integrated database retrieval system