KEGG   Shewanella baltica OS117: Sbal117_3416Help
Entry
Sbal117_3416      CDS       T02013                                 

Definition
(GenBank) Beta-lactamase
  KO
K07258  serine-type D-Ala-D-Ala carboxypeptidase (penicillin-binding protein 5/6) [EC:3.4.16.4]
Organism
sbs  Shewanella baltica OS117
Pathway
sbs00550  Peptidoglycan biosynthesis
sbs01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sbs00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Sbal117_3416
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:sbs01002]
    Sbal117_3416
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:sbs01011]
    Sbal117_3416
Enzymes [BR:sbs01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     Sbal117_3416
Peptidases and inhibitors [BR:sbs01002]
 Serine peptidases
  Family S11: D-Ala-D-Ala carboxypeptidase A family
   Sbal117_3416
Peptidoglycan biosynthesis and degradation proteins [BR:sbs01011]
 Peptidoglycan biosynthesis and degradation
  DD-Carboxypeptidase/DD-Endopeptidase (Low molecular weight PBP)
   Sbal117_3416
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_S11 PBP5_C Beta-lactamase2 Beta-lactamase
Motif
Other DBs
NCBI-ProteinID: AEH15095
LinkDB All DBs
Position
3935901..3937178
Genome map
AA seq 425 aa AA seqDB search
MKEPSLKPTVGKWYTVEDLLESFPFHTTKRRAKLMMNFVKSPIKTLLLISSASLPVYAAQ
PIITPDAPSVAAKAFVLMDYNSGQIIAESNAYESLNPASLTKMMTSYVIGQEIKAGNVSV
DDDVTISKNAWSKNFSDSSKMFIEVGTTVKVGDLNRGIIIQSGNDACVAMAEHIAGTEGA
FVDMMNSWAKQLGMRDSYFENAHGLDAENHKSTAYDMALLGAALIRDEPDEYHIYSEKFY
TFNGIKQYNRNGLLWDNSMNVDGIKTGHTSGAGYNLVASATKDGMRLISVVMGTQSESAR
KAESKKLLTYGFRFFETVTPYKAGDSFITQQIWYGDKSTVDLGVATDTPITISRGRGKDL
KANFELTKPLDAPLKKGETVGRLFFQLDGKDIAQFPLVTLQEVNEGSWFSKLVDYFKQMF
SGWFS
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atgaaggaaccttcactaaaacccactgtcggaaagtggtacactgttgaagatcttctc
gaatcctttccatttcatacaactaaaagacgtgccaagttaatgatgaattttgtaaaa
agtcccattaaaacattgctgctaatttccagtgcctctctccccgtttatgctgcgcag
cctattattacacctgatgcaccttcagtagccgccaaggcgttcgtattgatggattat
aattcgggtcagattattgctgaaagtaacgcttacgaaagccttaacccagccagttta
actaagatgatgaccagctacgtgatcggtcaagaaatcaaagcgggcaatgtctccgtt
gatgatgatgtgactatcagtaaaaatgcttggtctaaaaacttctcagactcttctaag
atgttcattgaagtgggcactacggttaaagtgggcgatctaaaccgcggtatcatcatt
caatcgggtaacgatgcgtgtgtggcgatggccgagcacattgccggtactgaaggcgcc
ttcgttgacatgatgaactcatgggcgaagcaattggggatgcgtgatagctacttcgaa
aacgcccacggtttagatgcagaaaaccacaaatccaccgcctatgatatggcattactg
ggcgcagcgttaatccgcgacgagccagatgaataccacatctatagcgaaaaattctat
acattcaatggtatcaaacaatacaaccgtaatggtttattgtgggataacagcatgaac
gtggacggtatcaaaaccggtcacacctcaggtgcgggctacaacttagtggcatcggca
accaaagacggcatgcgtttaatttcagtggtgatgggcactcaaagtgaatctgcccgt
aaagctgaaagtaagaaattactgacctatggcttccgtttcttcgaaaccgtaacacca
tacaaggcgggtgatagctttatcactcagcaaatttggtacggtgacaagagcacggtt
gatttaggcgtggcaactgacacacctatcaccatcagccgtggccgtggtaaagacttg
aaagctaacttcgagctgactaaaccattagatgcacctttaaagaaaggtgaaactgtt
ggccgtctattcttccaacttgatggtaaagacatcgcccagttcccactggtgacgttg
caagaagtcaacgaaggcagctggtttagtaaattagtagattactttaagcagatgttt
tctggatggtttagctaa

DBGET integrated database retrieval system