KEGG   Shewanella baltica OS678: Sbal678_1641Help
Entry
Sbal678_1641      CDS       T01725                                 

Definition
(GenBank) Pyridoxal-dependent decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
sbt  Shewanella baltica OS678
Pathway
sbt00410  beta-Alanine metabolism
sbt00430  Taurine and hypotaurine metabolism
sbt00650  Butanoate metabolism
sbt01100  Metabolic pathways
sbt01110  Biosynthesis of secondary metabolites
sbt01120  Microbial metabolism in diverse environments
sbt02024  Quorum sensing
Module
sbt_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:sbt00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    Sbal678_1641
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Sbal678_1641
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Sbal678_1641
   00430 Taurine and hypotaurine metabolism
    Sbal678_1641
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    Sbal678_1641
Enzymes [BR:sbt01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     Sbal678_1641
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC Beta_elim_lyase Aminotran_5 P53_tetramer
Motif
Other DBs
NCBI-ProteinID: ADT93813
LinkDB All DBs
Position
complement(1932082..1933731)
Genome map
AA seq 549 aa AA seqDB search
MTQKLPRQATASEESLLRIFTAPEDAGSTLSIIEQKLSEDLAGFLGDSIAALEKPLSEIE
TDFQAFEIPTQPRFVSDYTDEIMQNLVAHSVHTAAPSFIGHMTSALPYFVLPLSKMMVGL
NQNLVKIETSKAFTPLERQVLGMMHHLIYDQDTDFYQSWMHSANHSLGAFCSGGTVANIT
ALWIARNQLLKADGEFKGVSREGLLKALRHYGYDDLAILVSERGHYSLGKAVDLLGIGRD
NIISIPTGIDNKVDVAKMRQAALELASKNIKVLAIVGVAGTTETGNVDPLTELAALAKEL
NCHFHVDAAWGGASLLSNKYRHLLTGIELADSVTIDAHKQMYVPMGAGMVLFKDPEFAHA
IAHHAEYILRRGSKDLGSQTLEGSRPGMAMLVHACLQIIGRDGYEILINNSLEKARYFAE
QIKAHKDFELVTEPELCLLTYRYVPACVQAAIQLACEQADTIRVARFNELLDGLTQFIQK
HQREQGKSFVSRTRIQPARYFRQATVVFRVVLANPLTSHDILNQVLVEQSEIAALDNEFL
PVLMAMVAD
NT seq 1650 nt NT seq  +upstreamnt  +downstreamnt
atgacccagaaactccctcgccaagccacagcatccgaagaaagtctgctccgcattttt
actgcaccggaagatgcaggatcaacgctgagtattatcgagcagaagctctccgaggac
ttagcaggctttttgggtgacagtatcgccgcgctcgaaaaacccttgtcggaaattgaa
accgattttcaagcctttgagatcccaactcagccgcgtttcgtctccgattacaccgac
gagatcatgcaaaatctggtggcgcattcggtacacacagcggcaccaagttttatcggc
cacatgacgtcggcactgccctactttgtgttgccgctgtcgaaaatgatggtgggactg
aatcaaaatctggtcaaaatcgaaacctcaaaggcatttacgccgcttgagcgccaagtg
ctcggcatgatgcaccatttgatttacgaccaagatacggatttttatcaaagctggatg
cacagtgcgaatcattccctcggggcattttgctccggcggcacagtggccaacatcacc
gccctgtggattgcccgcaaccaattattgaaagccgatggcgagtttaaaggcgtcagc
cgcgaaggtttactcaaggcactgcgccactatggctatgacgatttagcgattttagtc
tcggagcgcggtcactattcgctaggcaaagccgtcgatctgcttggtatcggtcgtgac
aatatcatcagcattcccacgggcatcgataacaaggtcgatgtcgcgaaaatgcgccaa
gccgcccttgaacttgccagtaaaaacatcaaagtgttggcgattgttggtgtggctggc
accacagaaaccggtaatgttgacccattgacagaattagcggcgctggcaaaagagtta
aattgccatttccatgtggatgcggcgtggggaggcgcgagtttattatccaataaatac
cgccacttactcacaggtatcgaacttgccgattcagtcaccatagatgcccacaaacaa
atgtacgtgcctatgggcgcgggtatggtgttatttaaagacccagagttcgcccacgcc
attgcccatcacgccgaatatattctgcgccgtggttcaaaggacttaggcagccaaacg
ctcgaaggttcacgccccggcatggcgatgttagtgcacgcttgcttacagatcatcggc
cgcgatgggtatgaaatcttaatcaataacagccttgaaaaagcgcgttattttgccgag
caaatcaaagcccataaggattttgagctggtcactgagccagaactgtgtctgctgact
tatcgttatgtccccgcctgcgtccaagccgccatacagcttgcctgtgagcaagcagac
acgataagagtcgcccgctttaacgagctgctcgatggcctgacacagtttattcaaaag
caccaacgcgaacagggtaaatccttcgtctcccgcacccgcattcagccagcccgctac
tttaggcaagcgaccgtggtgtttcgcgtagtgctcgctaaccccctcaccagccatgac
atcctcaatcaagtgcttgttgagcaaagtgaaatcgccgcactagataatgagttttta
cccgtactcatggcgatggttgctgattag

DBGET integrated database retrieval system