KEGG   Sphaerochaeta globosa: SpiBuddy_1789Help
Entry
SpiBuddy_1789     CDS       T01439                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
sbu  Sphaerochaeta globosa
Pathway
sbu00473  D-Alanine metabolism
sbu00550  Peptidoglycan biosynthesis
sbu01100  Metabolic pathways
sbu01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:sbu00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    SpiBuddy_1789
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    SpiBuddy_1789
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    SpiBuddy_1789
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:sbu01011]
    SpiBuddy_1789
Enzymes [BR:sbu01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     SpiBuddy_1789
Peptidoglycan biosynthesis and degradation proteins [BR:sbu01011]
 Precursor biosynthesis
  Amino acid ligase
   SpiBuddy_1789
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N
Motif
Other DBs
NCBI-ProteinID: ADY13613
UniProt: F0RWI2
LinkDB All DBs
Position
1956696..1957778
Genome map
AA seq 360 aa AA seqDB search
MTIALVYGGRSTEHEVSIASALTVHRALKQAGYRVLLIAIALDGRWYLQPNLLSKSIDAT
IPIHAVPGLGLYVQDAKLDIDAVFATTHGYGGEDGNLQGLCMLCRLPLCGCDTVSSALGM
HKHLASELFMQALIPTVPTLLLDKNAVQQVEYTTLLERARSTLGPDLFVKPENSGSSVGV
SALKDCDAKALQQAVELARRYSERVLIQLLIHPLQELETAVLETRDKGLVVAGPGLVIDP
AKETVGFLSYEHKYGKVDTAHIRIPSGLDDTTETIIKNYARKAFLAIKGDGYARIDFFVS
ENRIYLNEINTSPGLTDTSHYPALLASVGYDLSSVCKHLVENALLRNAQEKLRIYTPPGY
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
atgaccatagcccttgtctatgggggaagatccaccgaacatgaggtttccatcgccagt
gccctgacagtgcatcgggccctcaagcaagcagggtatcgtgtactgcttatcgccatc
gccctcgatggccgatggtatttacagcccaatctgctaagcaaatcaatcgatgccacc
atacccattcatgcagttcctggtctcggactctacgtccaagatgcaaaactggatatc
gatgcagtctttgccaccacccacggttatggcggcgaggatggaaacctgcaaggccta
tgcatgctctgccgtctcccgctctgcggctgcgataccgtctcaagtgccttaggcatg
cataagcatttggcttctgaactgtttatgcaggcactcatacccaccgtaccgacgctg
ttgctggataagaatgccgtgcagcaggttgagtatactacacttctagagcgtgcccga
agcacccttggccctgatctatttgtaaaacctgagaacagtggctcttcggtaggcgtc
agtgccttgaaggactgtgacgccaaggccttgcagcaggctgttgaactggctcgccgt
tacagcgagcgtgttcttatccagctgctcatccatcccttgcaagaattggaaaccgca
gttctggaaacccgggacaaaggtcttgtggtggcaggaccgggcttggtgatcgacccc
gccaaggaaacagtaggctttctcagctacgaacacaagtacggcaaggtcgataccgcc
catatcagaatccccagcggtcttgatgacacaactgaaacaatcattaaaaactatgca
cgcaaggcattcttggcaataaagggtgatgggtatgcacgcatcgatttttttgtcagt
gaaaatcggatctatctcaatgaaatcaatacctctcccggcttgaccgacacaagtcac
taccccgccctgcttgcctcggttggctatgacctttcttctgtctgcaagcatttggtg
gaaaatgccttactgcgcaatgcacaagaaaagctgcgaatctatacaccacccggatat
tga

DBGET integrated database retrieval system