KEGG   Salmonella bongori serovar 48 z41 --: N643_00565Help
Entry
N643_00565        CDS       T03249                                 

Gene name
ddl
Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
sbv  Salmonella bongori serovar 48:z41:--
Pathway
sbv00473  D-Alanine metabolism
sbv00550  Peptidoglycan biosynthesis
sbv01100  Metabolic pathways
sbv01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:sbv00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    N643_00565 (ddl)
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    N643_00565 (ddl)
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    N643_00565 (ddl)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:sbv01011]
    N643_00565 (ddl)
Enzymes [BR:sbv01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     N643_00565 (ddl)
Peptidoglycan biosynthesis and degradation proteins [BR:sbv01011]
 Precursor biosynthesis
  Amino acid ligase
   N643_00565 (ddl)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N CPSase_L_D2 ATP-grasp_4 ATPgrasp_YheCD ATP-grasp_3 TTL ATP-grasp ATPgrasp_ST
Motif
Other DBs
NCBI-ProteinID: AID23992
LinkDB All DBs
Position
131563..132483
Genome map
AA seq 306 aa AA seqDB search
MADKIAVLLGGTSAERDVSLNSGAAVLAGLREGGIDAHPIDPKEIDVTQLKAMGFQKVFI
ALHGRGGEDGTLQGMLEQLGLPYTGSGVMASALSMDKLRSKLLWQGAGLPVAPWVALTRA
GFENGLSDDEKARISALGLPLIVKPSREGSSVGMTKVVEENALQSALSLAFQHDDEILIE
KWLCGPELTVAILGEEILPSIRIQPAGTFYDYEAKYLSDETQYFCPAGLEASREAALQSL
VLHAWKALGCTGWGRIDVMLDSDGQFYLLEANTSPGMTSHSLVPMAARQAGMSFSQLVIR
ILELAD
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atggctgataaaattgcagtcctgttgggcggaacctctgcggagcgggatgtctcgctg
aactccggtgcggcagtccttgctgggttgcgtgaaggcggcattgatgcgcatcccatc
gatccgaaagagatcgacgtcacgcagcttaaggcaatgggttttcagaaagtctttatc
gcgctgcatggccgcggcggtgaagatggaaccttacagggaatgcttgagcagcttggt
ctgccctataccggtagcggcgtaatggcctcggcgctttcaatggataaactgcgcagt
aaactgctgtggcagggcgcaggattaccggtcgcgccgtgggtcgcgctgacacgcgcc
gggtttgaaaacgggcttagtgatgatgaaaaagcgcgaatttcggcgctgggcttaccg
ttgattgtcaaacccagccgcgagggttccagcgtcggcatgaccaaagtggtagaagaa
aatgctttacagagtgcgttatcattggcttttcagcatgatgacgaaatactgattgaa
aaatggctgtgcggccctgaattaacagtggcgatactgggggaagaaattttaccgtca
attcgtatccaacccgcaggaaccttctatgattatgaggcgaagtatctctctgatgag
acacagtatttctgccctgccggtttagaagcgtcccgtgaagccgcattacagtcgctc
gtcctgcatgcatggaaagcattaggctgtacgggatgggggcgcattgatgtcatgctg
gacagtgatggtcagttttatctgctggaagccaatacctctccgggtatgaccagtcat
agcctggtgccgatggcggcgcgtcaggcgggaatgagcttctcgcagttagtgatacga
attctggagttggcggactga

DBGET integrated database retrieval system