KEGG   Salmonella bongori serovar 48 z41 --: N643_02570Help
Entry
N643_02570        CDS       T03249                                 

Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
sbv  Salmonella bongori serovar 48:z41:--
Brite
KEGG Orthology (KO) [BR:sbv00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    N643_02570
Enzymes [BR:sbv01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     N643_02570
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_binding_2 FAD_oxidored HI0933_like FAD_binding_3 Thi4 Glutaredoxin NAD_binding_8 K_oxygenase AlaDh_PNT_C DAO FMO-like
Motif
Other DBs
NCBI-ProteinID: AID24281
LinkDB All DBs
Position
571274..572869
Genome map
AA seq 531 aa AA seqDB search
MMMFFKQEITMLDTNMKTQLKAYLEKLTKPVELIATLDDSAKSAEIKELLAEIAELSPKV
TFKENNSLPVRKPSFLITNPGSEQGPRFAGSPLGHEFTSLVLALLWTGGHPSKEAQELLA
QIRDIDGDFEFETYYSLSCHNCPDVVQALNLMAVLNPRIKHTAIDGGTFQNEITERNVMG
VPAVFVNGKEFGQGRMTLSEIIAKVDTGAEKRAAEALNKREAYDVLIVGSGPAGAAAAVY
SARKGIRTGLMGERFGGQVLDTVDIENYISVPKTEGQKLAGALKAHVSDYDVDVIDSQSA
SKLIPAASEGGLHQIETASGAVLKARSVIIATGAKWRNMNVPGEDQYRTKGVTYCPHCDG
PLFKGKRVAVIGGGNSGVEAAIDLAGIVEHVTLLEFAPEMKADQVLQDKVRSLKNVDIIL
NAQTTEVKGDGSKVTGLEYRDRVSGDTHQVALAGIFVQIGLLPNTQWLEGALERNRMGEI
IIDAKCETSVKGVFAAGDCTTVPYKQIIIATGEGAKASLSAFDYLIRSKVA
NT seq 1596 nt NT seq  +upstreamnt  +downstreamnt
atgatgatgttttttaagcaggagataacgatgctcgacactaacatgaaaacccagctc
aaggcctaccttgagaaactgaccaaacctgttgagctgattgccacgctggatgacagc
gctaaatcggcagaaatcaaggaactgctggcggaaatcgccgaactttcaccgaaagtg
acctttaaagaaaataacagcctgcccgtgcgcaagccctcttttctgatcaccaatcca
ggctcggagcaggggccgcgctttgcgggctcgccgctgggccatgaatttacctcgctg
gtgctggcgctgctgtggacgggggggcatccgtctaaagaggcgcaggaactgctggca
cagatccgcgatattgacggtgattttgagttcgaaacctattattccctttcctgccac
aactgcccggacgtggtacaggcgctgaacctgatggcggtgttgaatccacggattaaa
catacggcgattgacggcggcaccttccagaatgaaatcaccgagcgtaacgtaatgggg
gttccggcggtatttgtgaacggtaaagagttcggccagggacgtatgactctgagcgaa
attattgccaaagtggataccggggcagaaaaacgagcggcggaagcgttaaacaaacgc
gaggcgtatgatgtactgattgtcggttccggtccggcaggggcggcggcggcggtttac
tcggcgcgcaaggggattcgtaccggtttgatgggcgaacgttttggtggccaggtgctg
gatactgttgatatcgaaaactatatttcagtgccaaaaaccgaaggccagaaactggcg
ggcgcgctgaaagcgcatgtcagcgattatgacgttgacgtcattgatagtcagagcgca
agtaaactgattccggcagcgtcagaaggcggattgcatcagattgaaaccgcgtccggc
gcagtattgaaagcgcgcagcgttatcatcgccactggcgccaaatggcgtaatatgaat
gtgcccggtgaagatcagtatcgcaccaaaggcgtgacttattgcccgcattgtgacggt
ccactgtttaaaggcaagcgtgttgccgttattggaggcggtaactctggcgttgaagcg
gctatcgatctcgcggggattgtagaacacgttaccctgctggagtttgcgccggaaatg
aaagccgaccaggtattgcaggataaagtccgtagtctgaaaaacgtcgatattattctg
aatgcgcaaaccaccgaagtgaaaggtgatggtagcaaggttacgggtctggagtatcgc
gatcgcgtcagtggtgacacgcatcaggttgcactggcggggatcttcgtgcagatcggc
ctgctgccgaatacccagtggctggaaggcgcgctggaacgtaaccggatgggcgaaatt
atcattgacgccaaatgtgaaaccagcgttaagggggtctttgcggcgggtgactgtacc
actgtcccttacaagcagattattatcgccacaggcgagggggcaaaagcctcgcttagt
gcctttgattatctgattcgcagcaaagtcgcctaa

DBGET integrated database retrieval system