KEGG   Salmonella bongori serovar 48 z41 --: N643_02645Help
Entry
N643_02645        CDS       T03249                                 

Definition
(GenBank) [citrate [pro-3S]-lyase] ligase
  KO
K01910  [citrate (pro-3S)-lyase] ligase [EC:6.2.1.22]
Organism
sbv  Salmonella bongori serovar 48:z41:--
Pathway
sbv02020  Two-component system
Brite
KEGG Orthology (KO) [BR:sbv00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    N643_02645
Enzymes [BR:sbv01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.22  [citrate (pro-3S)-lyase] ligase
     N643_02645
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Citrate_ly_lig HIGH_NTase1 Acetyltransf_1 Acetyltransf_10
Motif
Other DBs
NCBI-ProteinID: AID24292
LinkDB All DBs
Position
complement(586513..587589)
Genome map
AA seq 358 aa AA seqDB search
MFGNNVFTRVKRSENKKMAEIAQFLKVNDLSVDTTVEVFITVTRDDHLIACGGIAGNIIK
CVAISESVRGEGLALTLATELINLAWERHCTHLFIYTKTEYEALFKQCSFSTIASVPGVM
VLMENSTTRLKRYAESLATLRHEGKKIGCIVMNANPFTNGHRYLIQQAAAQCDWLHLFLV
KEDTSRFPYEDRLDLVLKGTRDIPRLTVHRGSEYIISRATFPCYFIKEQSVINHCYTEID
LKIFRQYLAPALGITHRFVGTEPFCAVTAQYNCDMRFWLETPTLPAPPIALVEIERLCFQ
ETPISASWVRKLLVKHDLTAIAPLVPDATLRYLQAMAERHPGSAAARQKSPALATGEK
NT seq 1077 nt NT seq  +upstreamnt  +downstreamnt
atgtttggcaataatgtatttacccgggtaaaacgctctgaaaataaaaaaatggcggag
atcgcacaatttctcaaagtgaatgatttaagcgtcgataccactgtcgaggtgtttatt
accgtcacccgtgatgaccatcttattgcctgcggcggcatcgccggaaatatcatcaaa
tgtgtggccatcagtgaatccgtacgcggtgaaggcttagcactaacgctggcgactgag
ctaatcaatctcgcctgggaacgtcactgcacccatctttttatttatacgaaaacggaa
tacgaagcgctgtttaaacagtgcagtttttcgacaatagccagcgtccccggcgtaatg
gttttaatggaaaatagtaccacccgactaaagcggtatgcggaatcgctggcgacatta
cgtcatgaaggaaagaaaattggctgtatcgtgatgaacgccaatcctttcactaacggc
catcgctatctaatccaacaggcggctgcgcagtgtgactggctgcatctgttcctggtc
aaagaagatacgtcacgctttccctatgaagatcgactcgatctggtgctgaaaggcact
cgcgatattccgcgcctgaccgttcaccgcggctccgaatacattatctctcgtgcgacg
tttccctgctatttcattaaagagcagagcgtcattaatcactgttataccgaaatcgac
ctgaagattttccgccagtatctggcgcccgcgcttggcatcacacaccgctttgtcggt
acggagccattttgcgccgttaccgcccagtacaactgtgatatgcgtttctggctggaa
acgccaacgcttcccgccccacccattgcgctggtggaaatagagcggctttgcttccag
gaaacgccgatatccgcctcttgggttcgcaaactgctggttaaacacgatctcacggct
atcgcgccgctggttcccgacgccaccctgcgctacttgcaggcgatggccgaacgccat
ccaggcagcgcggcggcccgtcaaaagtcccccgcattagcaacaggtgaaaaatga

DBGET integrated database retrieval system