KEGG   Salmonella bongori serovar 48 z41 --: N643_09260
Entry
N643_09260        CDS       T03249                                 
Name
(GenBank) UDP-N-acetylglucosamine 2-epimerase
  KO
K24258  UDP-N-acetyl-L-fucosamine synthase [EC:5.1.3.28]
Organism
sbv  Salmonella bongori serovar 48:z41:--
Pathway
sbv00541  O-Antigen nucleotide sugar biosynthesis
sbv01100  Metabolic pathways
sbv01250  Biosynthesis of nucleotide sugars
Module
sbv_M00923  UDP-L-FucNAm biosynthesis
Brite
KEGG Orthology (KO) [BR:sbv00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00541 O-Antigen nucleotide sugar biosynthesis
    N643_09260
Enzymes [BR:sbv01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.28  UDP-N-acetyl-L-fucosamine synthase
     N643_09260
SSDB
Motif
Pfam: Epimerase_2 Glyco_transf_28 LpxB
Other DBs
NCBI-ProteinID: AID27299
LinkDB
Position
complement(1956715..1957845)
AA seq 376 aa
MKKLKIMSVVGTRPEIIRLSRVLAKLDEHCEHILVHTGQNYDYELNEVFFNDLGVRKPDY
FLNAAGKNAASTIGQVIIKVDEVLESEKPEAMLVLGDTNSCISAIPAKRRKIPIFHMEAG
NRCFDQRVPEETNRRIVDHTADINMTYSDIAREYLLAEGIAADRIIKTGSPMFEVLSYYM
PQIDSSDVLSRLNLRAGEFFVVSAHREENVDSPKQLVKLATILNTVAEKYKLPVIVSTHP
RTRNRINEQGIEFHPNINLLKPLGFHDYNHLQKNSRAVLSDSGTITEESSIMNFPAVNIR
EAHERPEGFEEASVMLVGLECERVLQALEILATQPRGATRLLRQVSDYSMPNVSDKVVRI
VHSYIDYVKRVVWKEY
NT seq 1131 nt   +upstreamnt  +downstreamnt
atgaaaaaattaaaaattatgtctgtggttggtactcgtccagaaattattcgtttatca
cgcgttttggctaaacttgatgaacattgcgagcatatacttgttcatactggtcaaaac
tatgactatgaattaaatgaagtattctttaacgatttgggtgttcgcaagccagattat
ttcttaaacgctgcaggaaaaaatgcagcttcgaccattggtcaggttatcatcaaagtt
gatgaggtattagaatccgaaaaacctgaagcaatgttagtgttgggtgataccaactcc
tgtatttcagccatccctgccaagcgtcgtaaaatacctatcttccatatggaagctggg
aaccgttgtttcgatcagcgcgtacctgaagaaactaaccgacgcattgtcgaccatact
gctgacatcaatatgacttatagcgatattgcgcgtgaatatctattggctgaagggatc
gcagcggaccggatcattaaaaccggtagtcctatgtttgaggtgctttcttactacatg
ccccaaattgatagttcggatgttctttcacgcctgaatttacgtgctggtgaatttttt
gttgtgagcgcgcatcgagaagaaaatgtcgattctcccaagcaactggtcaagctcgca
acgattctcaacaccgttgctgaaaaatataaacttccggttatcgtttctacgcatccg
cggacacgtaatcgtatcaatgagcaagggattgaattccacccgaatattaatctactg
aagccgctgggtttccacgattacaaccacttgcagaagaattcgcgtgcagtactgtca
gacagcggtactatcactgaagaatcatccatcatgaattttccagcggtaaatattcgg
gaagcacatgagcgcccagagggctttgaggaagcatctgtcatgctggtggggctggaa
tgtgaacgtgtacttcaggctctggagattctggcaacgcagcctcgtggagcgacccgt
cttttacgacaagttagtgattacagtatgccaaatgtgtcggataaagttgttagaatc
gttcactcttatatagattacgtcaagagagtcgtctggaaagaatattga

DBGET integrated database retrieval system