KEGG   Salmonella bongori serovar 48 z41 --: N643_09265
Entry
N643_09265        CDS       T03249                                 
Name
(GenBank) UDP-2-acetamido-2,6-dideoxy-beta-L-talose 4-dehydrogenase
  KO
K19068  UDP-2-acetamido-2,6-beta-L-arabino-hexul-4-ose reductase [EC:1.1.1.367]
Organism
sbv  Salmonella bongori serovar 48:z41:--
Pathway
sbv00541  O-Antigen nucleotide sugar biosynthesis
sbv01100  Metabolic pathways
sbv01250  Biosynthesis of nucleotide sugars
Module
sbv_M00923  UDP-L-FucNAm biosynthesis
Brite
KEGG Orthology (KO) [BR:sbv00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00541 O-Antigen nucleotide sugar biosynthesis
    N643_09265
Enzymes [BR:sbv01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.367  UDP-2-acetamido-2,6-beta-L-arabino-hexul-4-ose reductase
     N643_09265
SSDB
Motif
Pfam: Epimerase Polysacc_synt_2 NAD_binding_4 RmlD_sub_bind GDP_Man_Dehyd FdtA 3Beta_HSD adh_short GPI Cupin_2
Other DBs
NCBI-ProteinID: AID27300
LinkDB
Position
complement(1957845..1958948)
AA seq 367 aa
MKVLITGADGFIGRNLCLRLQEKGGVDLIKIDRESSAIELETGLQEADFIYHLAGINRPK
NIEEFAEGNKNLTQQIVDFLLMNQKKTPIMISSSIQAELDNAYGQSKAAAEKQIERYAEK
SGAAFFIYRYPNVFGKWCKPNYNSFVATFCHNIANDIGITINDPAASVSLVYIDDVCTHA
LKLLTGTVDSGYKKVEPVYSITVGEVAELIYRFKESRSTLITETVGTGFTRALYSTWLSY
LPTDKFVYTVPSYCDNRGIFCEMLKTSSSGQFSFFTAHPGITRGGHYHHTKNEKFLVIRG
QAKFKFEHVITGERYELNVSCDEFKIVETVPGWTHDVTNIGKDELIVMLWANEIFNRDEP
DTIARAL
NT seq 1104 nt   +upstreamnt  +downstreamnt
atgaaagtcctgattactggtgctgatggctttattggacgtaacttatgtttgcgtctt
caggaaaaagggggcgttgaccttattaagattgatcgtgagtcaagtgctattgagctt
gaaacaggcctgcaagaagccgattttatttatcatcttgctggtatcaatcggcctaaa
aatattgaagagtttgctgaaggcaacaaaaatctgacgcaacagattgttgattttctg
ttgatgaatcagaaaaaaactccaattatgattagttcttctatccaggcagagctagat
aatgcgtatggtcagagtaaagcagcggctgaaaagcagatagaacgttatgcggaaaaa
agtggagctgcattttttatctatcggtatccaaatgttttcggaaagtggtgtaaacca
aattataactcattcgtagctactttttgccataatattgctaatgatatcggcattacc
atcaatgacccagcagcatcggtcagcttggtttatatcgatgacgtttgtactcatgca
ttaaagctccttacaggaacggttgatagtgggtataaaaaggtcgaaccggtctattca
ataacagttggggaggtggcagaattaatttatcgcttcaaggaaagtcgttctactctt
atcactgaaactgttggtactggattcactcgtgcattgtattcgacgtggttaagctat
ttgcctaccgacaagtttgtttatacggtgccatcctattgtgataatcgtggtatcttt
tgtgagatgttaaaaacgtcttcatcggggcagttttcctttttcacagcgcatcctggt
atcacgcgaggtgggcattatcaccacaccaaaaatgaaaagttccttgtcattcgtgga
caggctaaattcaaatttgagcatgttattaccggtgaacgttatgaattaaatgtttca
tgcgatgaattcaaaatcgttgaaacagttcccggttggacccatgacgttacgaacatt
ggtaaagatgaattaatagttatgctctgggcaaacgaaatttttaatcgtgatgagcca
gatactattgcgagagctctgtaa

DBGET integrated database retrieval system