KEGG   Salmonella bongori serovar 48 z41 --: N643_09270
Entry
N643_09270        CDS       T03249                                 
Name
(GenBank) UDP-glucose 4-epimerase
  KO
K15894  UDP-N-acetylglucosamine 4,6-dehydratase/5-epimerase [EC:4.2.1.115 5.1.3.-]
Organism
sbv  Salmonella bongori serovar 48:z41:--
Pathway
sbv00520  Amino sugar and nucleotide sugar metabolism
sbv00541  O-Antigen nucleotide sugar biosynthesis
sbv01100  Metabolic pathways
sbv01250  Biosynthesis of nucleotide sugars
Module
sbv_M00923  UDP-L-FucNAm biosynthesis
Brite
KEGG Orthology (KO) [BR:sbv00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    N643_09270
  09107 Glycan biosynthesis and metabolism
   00541 O-Antigen nucleotide sugar biosynthesis
    N643_09270
Enzymes [BR:sbv01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.115  UDP-N-acetylglucosamine 4,6-dehydratase (configuration-inverting)
     N643_09270
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.-
     N643_09270
SSDB
Motif
Pfam: Polysacc_synt_2 Polysacc_syn_2C Epimerase 3Beta_HSD GDP_Man_Dehyd NAD_binding_10 RmlD_sub_bind NAD_binding_4 NmrA Sacchrp_dh_NADP adh_short F420_oxidored Shikimate_DH KR NAD_Gly3P_dh_N
Other DBs
NCBI-ProteinID: AID27301
LinkDB
Position
complement(1958950..1959984)
AA seq 344 aa
MFKDKILLITGGTGSFGNAVLNRFLSTDIKEIRIFSRDEKKQDDMRKKYNNQKLKFYIGD
VRDYRSILNATRGVDFIYHAAALKQVPSCEFHPMEAVKTNVLGTENVLEAAIANEVKRVV
CLSTDKAVYPINAMGISKAMMEKVMVAKSRNINSNKTVICGTRYGNVMASRGSVIPLFVD
LIKAGRPLTITDPNMTRFMMTLEDAVDLVIYAFEHGNNGDIFVQKAPAATIDTLAIALKE
LLNVGDHPVNVIGTRHGEKLYEALLSREEMIAAIDMGNYYCVPPDLRDLNYGKYVEQGDS
RISVVEDYNSHNTQRLDVEGMKNLLLKLPFIRALCAGENYDLEA
NT seq 1035 nt   +upstreamnt  +downstreamnt
atgtttaaagataaaatactgctgattacgggtggaacagggtcttttggtaatgctgta
ttgaatcgctttctttctacagatataaaagaaattcgcattttctctcgtgatgaaaag
aaacaagatgatatgcggaaaaaatataacaaccagaagttaaagttttatattggtgat
gtcagagattatcgtagcattttgaatgcaactcgtggtgttgattttatataccatgca
gcggcgcttaagcaggtgccatcatgtgagttccacccaatggaagctgttaaaactaat
gtgctcggcacagagaatgtacttgaagctgctatcgctaatgaagtaaaacgcgttgtt
tgcttaagtactgacaaagcggtttatcctatcaatgccatgggaatttcaaaggcaatg
atggagaaagtgatggtggcaaaatcacgtaacataaatagtaataaaacggtgatttgt
ggaacacgctatggcaatgtgatggcttctcgtggttcggtgattcctttatttgttgat
ctcattaaagcgggtaggccattgacaattaccgatccaaacatgactcgatttatgatg
actcttgaagatgcagttgatcttgtaatttacgcatttgagcatggtaataatggtgat
atcttcgtacagaaggctcctgctgctacgattgatacattagcaattgcactgaaagaa
ctcttgaacgttggagaccatccagtcaatgttatcgggactcgccatggcgagaaatta
tatgaagcattacttagtcgcgaagagatgattgcggccattgatatgggtaattattac
tgcgttccacctgatttgcgtgaccttaattatggaaaatatgtagaacagggtgatagc
cgtatctctgttgttgaggattataactcccataatacacagcggctggatgtagaagga
atgaaaaatctgcttcttaaactaccgtttattcgcgcattgtgtgctggtgaaaattac
gatctggaagcctga

DBGET integrated database retrieval system