KEGG   Salmonella bongori serovar 48 z41 --: N643_10610Help
Entry
N643_10610        CDS       T03249                                 

Gene name
fadJ
Definition
(GenBank) fatty-acid oxidation protein subunit alpha
  KO
K01782  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
sbv  Salmonella bongori serovar 48:z41:--
Pathway
sbv00071  Fatty acid degradation
sbv00280  Valine, leucine and isoleucine degradation
sbv00281  Geraniol degradation
sbv00310  Lysine degradation
sbv00362  Benzoate degradation
sbv00380  Tryptophan metabolism
sbv00410  beta-Alanine metabolism
sbv00640  Propanoate metabolism
sbv00650  Butanoate metabolism
sbv00903  Limonene and pinene degradation
sbv00930  Caprolactam degradation
sbv01100  Metabolic pathways
sbv01110  Biosynthesis of secondary metabolites
sbv01120  Microbial metabolism in diverse environments
sbv01130  Biosynthesis of antibiotics
sbv01200  Carbon metabolism
sbv01212  Fatty acid metabolism
Module
sbv_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:sbv00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    N643_10610 (fadJ)
   00650 Butanoate metabolism
    N643_10610 (fadJ)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    N643_10610 (fadJ)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    N643_10610 (fadJ)
   00310 Lysine degradation
    N643_10610 (fadJ)
   00380 Tryptophan metabolism
    N643_10610 (fadJ)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    N643_10610 (fadJ)
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    N643_10610 (fadJ)
   00281 Geraniol degradation
    N643_10610 (fadJ)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    N643_10610 (fadJ)
   00930 Caprolactam degradation
    N643_10610 (fadJ)
Enzymes [BR:sbv01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     N643_10610 (fadJ)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     N643_10610 (fadJ)
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     N643_10610 (fadJ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2 Pectinesterase
Motif
Other DBs
NCBI-ProteinID: AID27350
LinkDB All DBs
Position
complement(2255654..2257801)
Genome map
AA seq 715 aa AA seqDB search
MTTPSAFTLNVRPDNVAVVAIDVPGEKMNTLKTEFAAQVRALLKQIRENKTLQGVVFISA
KADNFIAGADINMIEACQSAQEAETLARQGQQLMAEIQALPVPVIAAIHGACLGGGLEMA
LACHRRICTDDAKTVLGLPEVQLGLLPGSGGTQRLPRLVGISTALDMILTGKQLRARQAL
KTGLVDDVVPQSILLEAAVELAKKERLAQRRLPVRERILAGPLGRALLFRLVRKKTAQKT
QGNYPATERIIDVIETGLAQGSSSGYDAEARAFGELAMTPQSQALRAIFFASTQVKKDPG
SDAPPGPLHSVGILGGGLMGGGIAWVTACKGGLPVRIKDINAKGINHALKYSWDQLETKV
RRRHIKASQRDKQLSLISGSTDYRGFSHRDVVIEAVFEDLALKQQMVAEVEQHCAPHTIF
ASNTSSLPISDIAANAARPQQVIGLHFFSPVEKMPLVEVIPHASTSAQTIATAVQLAKKQ
GKTPIVVSDKAGFYVNRILAPYINEAIRMLTEGERIEHIDTALVKFGFPVGPIQLLDEVG
IDTGTKIIPVLEAAYGERFSAPANVVASILNDDRKGRKNGRGFYLYGKKGRKSKKQVDPA
IYKLINVQGQSRLSAQQVAERCVMLMLNEAARCFDERVIRSARDGDIGAVFGIGFPPFLG
GPFRYMDTLGAGEVVAALRRLATLYGPRYAPCEQLVRMAERREYFWTNEETDQRK
NT seq 2148 nt NT seq  +upstreamnt  +downstreamnt
atgactactccatcagcttttacgcttaacgtgcgcccggataatgtcgcggttgtcgct
atagatgtccctggggaaaagatgaacaccctgaaaacggagtttgccgctcaggtacgt
gcccttctgaagcagatccgggaaaataaaacgttacaaggcgtcgtttttatctcggct
aaggcggataactttattgctggcgccgatatcaacatgatagaggcctgtcaaagcgcg
caagaggcggaaacgctggcgcgtcaagggcagcaactgatggcggagattcaggcattg
cctgttccggtcatcgccgccattcacggagcctgtctggggggcggactcgaaatggcg
ctggcctgtcaccggcgtatctgtactgatgatgctaaaaccgttctcggcctgccggaa
gtgcagttagggcttttacccggatcagggggaacgcaacgacttccacggctggtgggg
atcagtaccgcgttggatatgatcctgacggggaagcagcttcgtgccagacaggcgctg
aagaccgggctggttgatgacgtggtaccacagtccattttactggaagcggcggttgag
ctggctaaaaaagaacgtctggcgcagcggagattacccgtacgcgagcgtatcctggcg
ggcccgttggggcgcgcgctgctatttcgcctggtgcgtaaaaagacagcgcaaaaaacg
cagggtaattatcctgcaacagaacgaatcattgacgtgattgaaaccggactggcgcag
ggaagcagtagtggttatgacgcggaagcccgcgctttcggcgagctggcgatgacgcct
caatcgcaggcgctgcgcgctattttctttgccagcacccaggtgaaaaaagatcccggt
agcgatgcgccgcccggcccgctgcatagcgtaggcatattgggcggcggattaatgggc
ggcggtatcgcctgggtcaccgcctgtaaaggcggcttgccagtacgcattaaggatata
aatgctaagggaatcaaccatgcactgaagtacagctgggatcaacttgaaactaaagta
cgccgacgccatatcaaagccagtcaacgtgataaacaactgtcattgatttcaggctcg
accgattatcgcggttttagtcatcgcgacgtggtcattgaagcggtatttgaagatctg
gcgttaaaacaacagatggtagcggaagtggaacaacattgcgcccctcacactattttc
gcctccaatacgtcttccttgccgattagcgatattgcggcaaacgcggccagaccgcag
caggtgattgggctgcacttttttagcccggtcgaaaaaatgccgctggttgaggtcatt
ccccacgcgtctacttccgcgcagacgatcgctacggccgttcaactggcgaaaaaacag
ggtaaaaccccgatagttgtcagtgataaagccggtttttatgttaaccgaatattggcg
ccgtacatcaacgaggcgattcgtatgctcaccgaaggggaacgtatcgaacatattgat
accgcgctggtaaaatttggttttccggtagggccaatccaacttttggatgaggtagga
atcgacacgggcactaaaattattcctgtgcttgaggcggcgtatggagaacgttttagc
gcgcctgcaaatgttgttgcttcaattttgaatgacgatcgcaaaggtagaaaaaatggt
cgcggtttctatctttatggcaaaaaagggcgtaaaagcaaaaaacaggttgaccctgct
atttataagcttattaacgtgcaagggcagagtcgactatctgcacagcaggtggcggag
cgctgtgtcatgttaatgctcaatgaagcggcacgctgtttcgacgaaagggtgattcgc
agtgcgcgcgatggtgatatcggcgctgtatttggtattggttttccgccgtttcttggc
ggcccgttccgttatatggatacgcttggcgcgggtgaagtagtggcggcgttgcggcgc
ctggctacgttatacgggccccggtacgcgccgtgtgagcaactggtgcgcatggcggag
cgcagggagtatttctggacgaatgaggaaactgaccagagaaaataa

DBGET integrated database retrieval system