KEGG   Salmonella bongori serovar 48 z41 --: N643_14245
Entry
N643_14245        CDS       T03249                                 

Definition
(GenBank) galactitol-1-phosphate 5-dehydrogenase
  KO
K00094  galactitol-1-phosphate 5-dehydrogenase [EC:1.1.1.251]
Organism
sbv  Salmonella bongori serovar 48:z41:--
Pathway
sbv00052  Galactose metabolism
sbv01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sbv00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    N643_14245
Enzymes [BR:sbv01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.251  galactitol-1-phosphate 5-dehydrogenase
     N643_14245
SSDB
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C AlaDh_PNT_C Methyltransf_25 2-Hacid_dh_C MTS TrkA_N ADH_zinc_N_2 Shikimate_DH UDPG_MGDP_dh_N 3HCDH_N PrmA Methyltransf_31 Pyr_redox_2 Met_10 Methyltransf_11 CoA_binding Sacchrp_dh_NADP ELFV_dehydrog Pyr_redox Fer4_4
Other DBs
NCBI-ProteinID: AID25985
LinkDB
Position
3039863..3040906
AA seq 347 aa
MKSVVIHAEGDVRVEERPVPQLQADDDVLVKVVSSGLCGSDIPRIFAQGAHYYPITLGHE
FSGYVESYGTGVTDMQPGDAVACVPLLPCFHCPQCERGYFSLCKQYQFVGSRSEGGNAEY
VVVKRANLFRLPSDMPIEDGALIEPITVGLHAFHLAQGCEGKNVIIVGAGTIGLLALQCA
RELGARSVTAIDINPQKLELAKALGATYTCNSQEMTAADIQNALSDVQFEQLILETAGTP
QTVSLAIDIAGPRAQLALVGTLHHDLSLQARTFGLILRKELTLLGSWMNYSAPWPGEEWE
TAARLLSEKRLQLSPLIAHRGDAASFAEAVKALNGAPMQGKILLQLS
NT seq 1044 nt   +upstreamnt  +downstreamnt
atgaaatcagtggttattcacgctgagggagacgtacgcgtcgaagaacgccctgtgcca
caactgcaagccgacgacgatgtattggtaaaggtcgtcagttccgggctttgcgggtcg
gatatcccacgtattttcgcgcagggcgcgcattattatcctatcacgttaggtcatgaa
ttcagcggctacgttgaatcctacggcacaggcgtaacggatatgcagcccggcgatgcc
gtcgcttgtgtcccgcttctgccctgttttcactgcccgcaatgcgaacgtggttacttt
tctttatgcaaacagtatcagtttgtaggatcgcgtagcgaaggcggtaatgcagaatat
gtggtggtcaaacgggccaatcttttccgcttgccatctgatatgccgattgaagatggc
gcattgatcgaaccgattaccgtaggcttgcacgcctttcatctggcgcagggctgtgaa
gggaaaaacgttattatcgtcggtgccgggaccattggcttgctggcattacagtgcgcg
cgagaactgggcgcccgcagcgtgacggcgattgatatcaatccgcagaaactggaactt
gcgaaagcgctgggcgcaacgtacacctgtaacagccaggagatgactgccgccgatatt
cagaacgcgttgtccgacgtacagtttgagcaactgatactcgaaacggcaggcactccc
caaaccgtctctctggctatcgatatcgccgggccgcgcgcgcagttggcgctggtcggt
acgttacaccacgacctgtctctgcaggcgcgcacattcggcttaattttgcgtaaagaa
ctgacgctcctcggcagttggatgaactattccgcgccgtggccaggcgaagagtgggaa
accgcagcgcgtctgttaagcgaaaaacgtcttcaactctcccctctcattgcccatcgt
ggcgatgcagcaagctttgcagaagcggttaaagcgcttaatggcgcccctatgcaaggc
aaaatcctgcttcaactttcctga

DBGET integrated database retrieval system