KEGG   Salmonella bongori serovar 48 z41 --: N643_15535Help
Entry
N643_15535        CDS       T03249                                 

Gene name
glpD
Definition
(GenBank) glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
sbv  Salmonella bongori serovar 48:z41:--
Pathway
sbv00564  Glycerophospholipid metabolism
sbv01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sbv00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    N643_15535 (glpD)
Enzymes [BR:sbv01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     N643_15535 (glpD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C NAD_binding_8 FAD_oxidored 3HCDH_N Pyr_redox_2 FAD_binding_2 Lycopene_cycl GIDA
Motif
Other DBs
NCBI-ProteinID: AID26185
LinkDB All DBs
Position
3285528..3287036
Genome map
AA seq 502 aa AA seqDB search
METKDLIVIGGGINGAGIAADAAGRGLSVLMLEAQDLACATSSASSKLIHGGLRYLEHYE
FRLVSEALAEREVLLKMAPHIAFPMRFRLPHRPHLRPAWMIRIGLFMYDHLGKRTSLPGS
TSVRFGADSVLKPEIVRGFEYSDCWVDDARLVLANAQMVVRQGGEVLTRTRATSARREKG
LWIVEAEDIDTGKKYIWQARGLVNATGPWVKQFFDEGMHLPSPYGIRLIKGSHIVVPRVH
NQKQAYILQNEDKRIVFVIPWMEEFSIIGTTDVEYKGDPKAVKIEESEINYLLKVYNAHF
QKQLGRDDIVWTYSGVRPLCDDESDSPQAITRDYTLDIHDENGKAPLLSVFGGKLTTYRK
LAEHAMEKLAPWYPGIGPAWTKTCVLPGGDIDGSREDYAAKLRRRYPFLTESLARHYSRT
YGSNTEWILGEATSLLDLGEDFGHEFYEAELKYLVDHEWVRRTEDAIWRRTKEGMWLTAE
QQSRITQWLAEYVGKRQLSLAS
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
atggaaaccaaagatctgatcgtgataggcgggggcattaacggtgcgggcatcgcggct
gatgccgccggacgcggtttgtccgtactcatgctggaagcacaggatttggcctgcgcg
acctcttccgccagttctaaacttatccacggcggcttacgctacctggaacactatgaa
tttcggctggtcagcgaagcgctggcagaacgtgaagtactgttgaaaatggcgccgcat
attgccttcccgatgcgctttcgtctgccgcatcgcccgcatttacgtccggcatggatg
attcgcattggtctgtttatgtacgatcacctgggaaaacgtaccagtttacccggctct
accagcgtgcggtttggcgcagattcggtgctgaaacccgaaatcgtgcgcggtttcgaa
tattcggactgctgggtagatgatgcccgtctggtgctggccaatgcgcagatggtggta
cgccagggcggggaagttcttacccgcacgcgtgcaacctccgctcgccgggagaagggt
ctgtggattgtcgaagcggaagatatcgataccggtaaaaaatatatctggcaggcgcgc
ggactggtcaacgcgaccgggccgtgggtcaaacagttcttcgacgaagggatgcacctg
ccgtcgccttatggcatccgcctgatcaaaggcagccatatcgttgtgccgcgcgtccat
aatcagaagcaggcgtatattctgcaaaacgaagataaacgaatcgtctttgtcatccca
tggatggaagagttttcgatcatcggcacaaccgatgttgaatataaaggcgatccgaaa
gcagtaaaaattgaagaaagtgaaattaattacctgttgaaggtttataacgcgcatttc
caaaagcaattgggacgcgatgacatcgtctggacatactccggcgtgcgtccgctgtgt
gatgatgagtctgactcaccgcaggctatcactcgtgattacaccctggatatccacgat
gaaaacggcaaagcaccgctgctttccgtgtttggcggtaagctgacgacctaccgtaag
ctggccgaacacgcgatggaaaaactggcgccctggtatccaggcatcgggccggcatgg
accaaaacgtgcgtactgcccggtggcgacatcgacggcagccgcgaagattacgcggcc
aaactgcgtcgtcgttatccgttcctgacggaatcgctggcgcgccactattcgcgtact
tacggcagcaatacagagtggattctcggcgaagccacatcactgcttgatttaggcgaa
gatttcggccatgagttttacgaagcggagctcaaatatctggtggatcacgaatgggtg
cgccgtactgaagacgctatctggcgacgtaccaaagaaggcatgtggctgaccgctgag
cagcagtcgcgcattacccagtggttggcggagtatgttggcaaacgccagctgtcgctg
gcgtcgtaa

DBGET integrated database retrieval system