KEGG   Salmonella bongori serovar 48 z41 --: N643_15705Help
Entry
N643_15705        CDS       T03249                                 

Definition
(GenBank) 4-aminobutyrate aminotransferase
  KO
K00823  4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
sbv  Salmonella bongori serovar 48:z41:--
Pathway
sbv00250  Alanine, aspartate and glutamate metabolism
sbv00410  beta-Alanine metabolism
sbv00640  Propanoate metabolism
sbv00650  Butanoate metabolism
sbv01100  Metabolic pathways
sbv01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:sbv00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    N643_15705
   00650 Butanoate metabolism
    N643_15705
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    N643_15705
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    N643_15705
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:sbv01007]
    N643_15705
Enzymes [BR:sbv01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     N643_15705
Amino acid related enzymes [BR:sbv01007]
 Aminotransferase (transaminase)
  Class III
   N643_15705
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2 DUF1869 Beta_elim_lyase
Motif
Other DBs
NCBI-ProteinID: AID26211
LinkDB All DBs
Position
complement(3326341..3327606)
Genome map
AA seq 421 aa AA seqDB search
MKSAELNHRRQQATPRGVGVMCDYFVKKAENATLWDVEGNEVIDFAAGIAVLNTGHRHPK
IVAAVEQQLQAFTHTAYQIVPYESYVSLAERINAIAPVDGPAKTAFFTTGAEAVENAVKI
ARAYTGRPGLITFGGGFHGRTFMTMALTGKVAPYKIGFGPFPGSVYHAVYPNAAHGVSVD
DALKSLERIFKADIAADQVAAIVLEPIQGEGGFNVAPAAFMQALRQLCDTHGILLIADEV
QTGFARTGKVFAMQHYAVKPDLMTMAKSLAGGFPLSGVVGRAEVMDAPAPGGLGGTYAGN
PLAVAAAHAVLDIIEEEQLCQRANQLGEHLQEVLNQARASCPAIADVRGLGSMVAVEFND
PQSGEPSAEYTRQVQRKAQENGLLLLSCGVYGNVIRFLYPLTIPDAQFSKALDILARVLR
A
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaagtgctgaactgaatcatcgtcgccagcaggcgactccccgtggcgtaggtgta
atgtgcgactactttgtaaagaaagcggagaacgccacgctgtgggatgtggaaggcaat
gaagtgatcgactttgccgccgggatcgccgtgctgaataccggacatcgccatccgaag
attgtggcggcggtagagcagcagttgcaggcgtttacccataccgcttaccagattgtc
ccttatgagagttacgtctcgctggcagaacgcattaatgctatcgcccctgtcgacggg
ccagcaaaaaccgcgttttttaccaccggtgccgaagcggttgaaaatgctgtaaaaatt
gcccgcgcctacactggacgcccgggacttattacctttggcggtggttttcatggccgt
acattcatgaccatggcgctgaccggcaaagtggctccctacaaaattggctttggcccg
ttcccgggctcggtttaccacgcggtctatccgaacgctgcccacggggtttccgttgac
gatgcgctcaagagcctggaacgtatctttaaagcggatatcgccgccgatcaggtcgcc
gcgattgtgctggagcccattcagggcgaaggcggtttcaacgtcgcgcccgccgctttt
atgcaggcgttgcgccagttgtgcgatacccacggcattttgctgattgccgacgaagtg
caaaccggctttgcccgtaccggcaaggtgtttgcgatgcagcactatgcggtgaaaccc
gatctgatgacgatggcgaaaagcctggcaggtggcttcccgctatcgggtgttgtgggg
cgtgccgaagtaatggatgcccctgcgccgggtggattaggcggaacttatgccggtaat
ccgctggcagtagccgccgcgcatgcggtgctggatattattgaagaagaacagctctgc
cagcgggctaatcaactgggtgaacatctgcaagaggtgctgaatcaggcgcgcgcaagc
tgtccggcgattgcggatgtgcgtggtctggggtcgatggtggcagtagagtttaacgat
ccgcaaagcggcgagccgtctgcggaatatacccgccaggtacagcgcaaagctcaggaa
aacggcctgctgctgttgagctgcggtgtctacggtaacgttatccgtttcctttatccc
ttaacaatcccggatgcccagttcagcaaagcgctggatattctggcccgtgtgctgcgc
gcctga

DBGET integrated database retrieval system