KEGG   Candidatus Tachikawaea gelatinosa: TGUWTKB_0500Help
Entry
TGUWTKB_0500      CDS       T03624                                 

Gene name
fabI
Definition
(GenBank) enoyl-[acyl-carrier-protein] reductase [NADH]
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
sbw  Candidatus Tachikawaea gelatinosa
Pathway
sbw00061  Fatty acid biosynthesis
sbw00780  Biotin metabolism
sbw01100  Metabolic pathways
sbw01130  Biosynthesis of antibiotics
sbw01212  Fatty acid metabolism
Module
sbw_M00083  Fatty acid biosynthesis, elongation
sbw_M00572  Pimeloyl-ACP biosynthesis, BioC-BioH pathway, malonyl-ACP => pimeloyl-ACP
Brite
KEGG Orthology (KO) [BR:sbw00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    TGUWTKB_0500 (fabI)
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    TGUWTKB_0500 (fabI)
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    TGUWTKB_0500 (fabI)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:sbw01004]
    TGUWTKB_0500 (fabI)
Enzymes [BR:sbw01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     TGUWTKB_0500 (fabI)
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     TGUWTKB_0500 (fabI)
Lipid biosynthesis proteins [BR:sbw01004]
 Fatty acid synthase
  Component type
   TGUWTKB_0500 (fabI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short Polysacc_synt_2
Motif
Other DBs
NCBI-ProteinID: BAP58309
UniProt: A0A090AL46
LinkDB All DBs
Position
55923..56708
Genome map
AA seq 261 aa AA seqDB search
MGFLSGKRILITGVASKRSIAWGIAKAMHQQGAELAFSYQKKKLQSRIENFAKELKSNIV
LLCDVSSDKNIKFMFNELKNFWKNFDGFVHAVAFAPIDQLDGDYLTQVSREGFITAHEIS
SYSFAAMAKESCNMLNEQSSLLTLSYLGAEKVILNYNVMGLAKASLEANVRYMANSLGKN
NIRVNGISAGPIRTLAASGIKNFKKMLSHFQSVTPLKRNVTIEDIGNVAAFLCSNLANGI
TGEIIHVDNGYNIVSINQLNY
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atgggttttctttcaggtaaacgtattttaattactggtgtagcaagtaaaagatccatt
gcatggggcatagcaaaagctatgcatcaacaaggagctgaattagcttttagctatcaa
aaaaaaaagttacagagtcgaatagaaaattttgcaaaagaactaaaatctaatattgtt
ttactttgtgacgtatcgagcgataaaaacataaaatttatgtttaatgaattaaaaaat
ttctggaaaaattttgatggttttgtacatgcagttgcatttgctcctattgatcaattg
gatggcgactacttaacacaagttagtagagaaggttttattactgcgcatgaaattagt
tcttatagttttgctgcaatggcaaaagaatcttgtaatatgttaaatgagcaatctagt
ctattaacactatcatatttgggtgccgaaaaagttattttaaactataacgttatgggc
ttagctaaagcttctttagaagctaatgttcgttatatggcaaattcactaggaaaaaat
aacattcgtgtaaatggaatttctgctggtccaataagaactcttgctgcatctggtata
aaaaattttaaaaaaatgctatcacattttcaatcagtaactccattaaaaaggaatgta
actattgaagatataggcaatgttgctgcttttctttgttcaaatcttgccaatggaata
acaggagaaattattcatgttgataacggatataatattgtttcaataaatcaattaaat
tactga

DBGET integrated database retrieval system