KEGG   Sphingobacteriaceae bacterium GW460-11-11-14-LB5: CA265_04945Help
Entry
CA265_04945       CDS       T05546                                 

Definition
(GenBank) bifunctional UDP-N-acetylmuramoyl-tripeptide:D-alanyl-D-alanine ligase/alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
sbx  Sphingobacteriaceae bacterium GW460-11-11-14-LB5
Pathway
sbx00473  D-Alanine metabolism
sbx01100  Metabolic pathways
sbx01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:sbx00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    CA265_04945
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    CA265_04945
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:sbx01011]
    CA265_04945
Enzymes [BR:sbx01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     CA265_04945
Peptidoglycan biosynthesis and degradation proteins [BR:sbx01011]
 Precursor biosynthesis
  Racemase
   CA265_04945
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C Mur_ligase_M Mur_ligase_C Mur_ligase
Motif
Other DBs
NCBI-ProteinID: ARS39055
UniProt: A0A1X9Z1J2
LinkDB All DBs
Position
1177210..1179669
Genome map
AA seq 819 aa AA seqDB search
MQNPIYTIAKIAEILNADAKLVDEQVIIQYLVIDSRSVLVSENSVFFALSQHRDGHEFIK
DAYTKEIRNFVITEAKYINEYPDCNFLLVDDALAALQKLAIEHRNQFDLKTIGITGSNGK
TIVKEWLYQLLATDFNIVKSPKSYNSQIGVPLSVWQIESDHTLGIFEAGISAVNEMQRLA
EIIHPEIGILTNIGEAHAEGFSSKKEKLTEKLKLFAASELFIYSPEYVTEISAKELPGKK
QFSWSSKQAADLQIIAVEPIEGNCYLRAIYQDREIECILPFKDKASIENGMICWATLLAL
DYTPEQADLRLEKLSHVSMRLELKNGINQCSIIDDSYSADISSLAIALDFLNQQNQHAKK
TVILSELFETGRDDLDLYTEIAELLLQKKVNRLIGIGTHISKYADLFKFETQFFDDTNAF
IDAFPGLQFNHETILVKGARRYEFGRISKLLTQKIHDTVLEIDLNAMVSNLQFYRSKIKP
GVKMMAMVKAFSYGSGSFEIANLLQFHKVDYLAVAYADEGIALRKAGITLPIMVMSPEES
AFEAIIKHKLEPEIYSIEILNSFLNALSDYDFDYPIHIKIDSGMHRLGFDQPEIDTLSNL
LKDSAKVKVQSVFSHLVASDAAEHDGFTQQQIERFKIIADQLLEALSYKPLLHISNTSGI
SRWPEGQMDMVRLGIGLYGFDSALANNRGLQTVMTLKTTVTQVKTLAPGETVGYSRKGVM
PNGGKIATVKIGYADGYTRYFGNGVGKMLINGHLVPTIGSICMDMTMLDITGIDVKPGDE
AIVFNKAHTIMQLARDIGTIPYEILTNISQRVKRVYFYE
NT seq 2460 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaatccaatatacaccattgccaaaatagccgaaattttaaatgccgatgccaaa
ttagttgatgaacaggtgattattcaatatctggtgatcgatagccgttcggttttggtg
tctgaaaattctgtgttttttgccctttctcagcaccgtgacggacatgaatttattaaa
gatgcctacacaaaggaaatcagaaattttgtcattaccgaagcgaaatacattaacgaa
tatcccgactgcaattttttactggtagacgatgctttggcggcgcttcaaaagcttgca
attgaacaccggaatcaatttgacctaaaaacaattggtatcacggggagtaatggaaaa
acgattgttaaagaatggttatatcaacttttagcaaccgactttaatatcgttaaaagt
ccgaaaagttataattcacagataggcgttccgctttcagtatggcagatcgagtccgat
cataccctaggcatttttgaagctggtatttctgcggttaacgaaatgcaacgtttagct
gaaattatccaccctgaaatcggaatactaaccaatattggtgaagcacatgccgaagga
ttcagctccaaaaaggaaaaactaaccgagaagctgaaactttttgcagcatctgaactg
tttatttattcgcccgaatatgtaaccgaaatcagtgcaaaagaacttcctggtaaaaaa
caattcagctggagcagtaaacaagcggcagatcttcagattattgcggttgaacccatt
gaaggaaactgttatttacgggccatttatcaagacagagaaattgaatgcattttgcct
tttaaagataaagcttcgatagaaaatggaatgatctgctgggcaaccttactggcattg
gattatacgccggagcaagccgatttacgtttggaaaaactgagccatgtgagcatgcgt
ttggaactgaaaaatggtatcaatcaatgttctattattgacgattcttacagcgccgat
atttcttccttagccattgccctcgattttttaaatcagcagaatcagcatgcaaagaaa
accgttatcctttccgaactatttgaaacggggagagatgacctggatttatatacagaa
atagccgaattgcttttgcagaagaaagtaaaccgactgattggaattgggactcatatt
tcgaagtatgctgatctttttaaatttgagacgcagtttttcgacgatacgaatgctttt
attgatgctttccctggtttacagtttaaccacgaaaccatattggtaaaaggggccagg
cgctacgagtttggccggatcagtaaactccttacccagaaaatacacgatacggtttta
gaaatcgatctgaatgccatggtgagtaatctgcaattttaccgttctaaaatcaaacca
ggcgttaaaatgatggccatggttaaggccttttcgtatggtagcggaagtttcgaaatt
gccaatttattgcagtttcataaggtagattatctggcagtagcttatgccgatgaaggt
attgccttgcgtaaagcgggcattacgttgcccattatggtgatgagtcctgaggaatct
gctttcgaagccatcattaaacataaactcgagcccgaaatttatagtatcgaaatcctg
aatagttttttaaatgcactgtctgattatgatttcgattatccgatccacattaaaata
gatagtggaatgcatcgtttgggctttgatcagcctgaaattgataccttgtctaatctg
cttaaagattcagcgaaggtcaaagttcaaagtgttttttctcacctggtggcaagtgat
gctgcagaacatgatggatttacacaacaacagattgaaaggtttaaaatcatcgcggat
cagctgcttgaagctttaagttataaaccgctgcttcatatctccaatacttcaggcatt
tcgcgttggcccgaagggcaaatggatatggtacgcctggggataggtttgtatggtttt
gattctgctttggctaataaccggggtttacagaccgtaatgacacttaagactacggtt
acccaggtgaagacgctggctccgggcgaaactgtgggttatagcaggaagggtgtaatg
ccaaatggagggaaaatagcgacggtaaaaataggctatgcagacggatacacccgatat
tttggcaacggagtgggtaaaatgcttatcaatggccatctggtgcccaccattggctcg
atctgcatggatatgaccatgttggatattacaggtattgatgttaaacctggtgatgaa
gctattgttttcaataaagcgcacaccattatgcagctggcgagagatatcggtaccatt
ccatatgaaattttaaccaatatctcgcaaagggttaaaagggtttatttctatgagtaa

DBGET integrated database retrieval system