KEGG   Sphingobacteriaceae bacterium GW460-11-11-14-LB5: CA265_06915Help
Entry
CA265_06915       CDS       T05546                                 

Definition
(GenBank) DNA ligase D
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
sbx  Sphingobacteriaceae bacterium GW460-11-11-14-LB5
Pathway
sbx03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:sbx00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    CA265_06915
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:sbx03400]
    CA265_06915
Enzymes [BR:sbx01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     CA265_06915
DNA repair and recombination proteins [BR:sbx03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     CA265_06915
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LigD_N DNA_ligase_A_M DNA_ligase_A_C mRNA_cap_enzyme GH3
Motif
Other DBs
NCBI-ProteinID: ARS39396
UniProt: A0A1X9Z2C3
LinkDB All DBs
Position
1718225..1720921
Genome map
AA seq 898 aa AA seqDB search
MSLKKYVAKRDFSKTTEPKSGKSSDRNKLHFVIQKHDASRLHYDFRLEMEGVLKSWAVPK
GPSTDPKTKRLAMMVEDHPYDYKDFEGIIPQGEYGGGTVIVWDEGTYEPIETIKGKKAQE
KHLLGQLKDGSLKIKLNGEKLHGEFALVKTHGMGENGWLLIKHKDDYASVKDITKEDKSV
LSGKTIEKMEKTSDKVWKEGKEQDLKTEKKSPKGKVKKETKAVGDDVVVDVKAILKKAPK
TAIPKGIKPMLATLVDEPFDDPDWQYEVKWDGYRALAFVNKGKVDLLSRNNKSFNEKFYP
IYDLLLGWKMNAVLDGEILVLNSKGVSNFGSLQNWRSEADGELVFYVFDILWYDGKNLME
LPLYQRQAILNEVLPTDDDRVRLGKVFKASGVDFFDAASRMGLEGIIAKKTDSIYATDRR
SKEWLKIKVQKRQEVVIAGFTKNADTAKSFSSLLLGVYEKGKLQYVGKVGTGFSDKLQKT
MMEQFKPIIIDKSPFESIPDVNKPSRFRPNPPKAQATWLKPELVCEVAFTEVTEDGVFRH
PSFQGMREDKKAKEVVREAEMPTDQIVDDTKEKSPHAAAIKAPKGKEPKTLLNPKDETQV
RKVKGHELKFTNLSKIYWPEDKVTKRDMFNYYYQVAEYIMPYLKDRPQSLNRFPGGIHGP
SFYQKDVKGKAPDWAETFPYENGEGEKKEYLVGTDEASLLWMASLGCIEMNPWFSRVQSP
DNPDYCVIDLDPDKHTFDQVVQAALETKKVLDAINVPGYCKTSGSTGMHIYIPLNAKYTY
EQSQMFAKIVVNLVHNQIPEYTSLERMVAARKGKMYLDFLQNRPGATIAGPYSLRPKIGA
TVSMPLHWDEVKPGLKMKDFNIFNTIDRLKVEGDLFKGVLGKGIDLMKAIDKAKSVFG
NT seq 2697 nt NT seq  +upstreamnt  +downstreamnt
atgagtctgaaaaagtatgttgccaaacgcgatttctccaaaactaccgaaccaaaatcg
ggcaaaagcagcgatcggaataaattacattttgtaatccaaaaacatgatgcttcgcgg
ctgcattacgatttcagactcgaaatggaaggtgtgctaaaaagctgggccgtaccgaaa
ggcccctcaaccgatccaaaaaccaaacgtctggccatgatggtagaggatcatccatac
gattataaagattttgaaggcattatcccacaaggcgaatacggtggcggaaccgttatt
gtatgggatgaaggaacttatgagcctattgaaacgattaagggcaaaaaagcacaggaa
aaacatttattaggtcagttaaaagatggttctttaaaaatcaagctcaacggagaaaaa
cttcatggcgagtttgcacttgtgaaaacccatgggatgggcgaaaacggctggctgtta
atcaaacataaagatgattatgcttctgtaaaagacattaccaaagaagataaatcggtg
ctttctggaaaaacaatcgaaaagatggaaaaaacatccgataaggtttggaaagaaggg
aaggagcaggatttaaaaactgaaaaaaaaagcccgaaaggaaaagtaaagaaagaaacc
aaagcggtgggtgatgacgtcgtggtagatgtaaaagccatactgaagaaagcccctaaa
accgctattccaaaaggcataaaacccatgctggccaccttggttgacgaacctttcgac
gatcctgattggcaatatgaggtaaaatgggatggttatcgtgccctggcctttgtcaat
aaaggaaaggttgatctgttgtcaagaaataataaatcctttaacgaaaaattttatccc
atttacgatctgcttttgggctggaaaatgaatgcggtattggatggtgagattttggtt
ttaaatagcaaaggtgtgtctaattttggctcgctgcagaactggcgaagcgaagctgac
ggagaacttgttttttatgtgttcgatattctctggtacgatggtaaaaacctgatggaa
ctgccactttaccagcgacaagccatattgaacgaggtactgccaactgatgatgaccgt
gtgcgccttgggaaagtttttaaagccagtggagtagacttttttgatgcggccagcaga
atgggcttggaaggcattattgccaaaaaaacggatagtatttatgcaacagaccggaga
tcgaaagaatggctgaaaattaaggtacagaagcggcaggaagtggttattgccggtttc
accaaaaacgccgatactgctaaatctttcagctctttactattaggcgtgtatgaaaag
ggaaaactacaatatgtgggcaaagtagggactggtttttcagataaacttcagaaaacc
atgatggagcagtttaagccgattattatcgataaaagccccttcgagagtattcctgat
gtaaataaaccctcccgcttcaggccaaatccaccaaaagcacaagccacctggttaaag
ccagaattggtatgcgaggttgcttttactgaagtaacggaagatggtgttttccgtcac
ccgtctttccagggcatgcgtgaagataaaaaagccaaagaagtggtaagggaagccgaa
atgcctacagatcaaattgtcgacgacactaaagagaaaagtccccatgcagcggcaata
aaagctccaaaaggtaaagaacctaaaactttgttaaatccgaaagatgaaacacaggtc
aggaaagttaaaggccacgaacttaaattcaccaacttaagtaaaatatattggcccgaa
gataaggtaaccaaaagagatatgtttaactactattaccaggttgctgaatatataatg
ccttacctgaaagaccggcctcaatcgcttaaccgctttccgggtggaatacatggtccg
agtttttaccagaaagatgtaaagggaaaagcaccagactgggccgaaactttcccctat
gaaaatggcgaaggtgaaaaaaaagaatacctggtgggaacggatgaagcttcattactc
tggatggccagtttaggctgtatagaaatgaatccctggtttagccgggtacaaagtccc
gataatccagattactgtgtaattgatttagatcccgataagcatacttttgatcaggtg
gtacaggccgctctggaaactaaaaaagtattggatgccataaatgttcccggttattgt
aaaacctcaggttcaaccggaatgcatatttacattcccttaaatgccaaatatacttat
gagcaaagtcagatgtttgctaaaatagtggtcaacctggtgcacaatcaaatccctgaa
tatacttcgctcgagcggatggtggcggccagaaaaggtaaaatgtatttagattttttg
cagaataggccaggggcaaccattgccggaccttattcattgcgcccgaaaattggtgca
accgtatcaatgcctctgcattgggatgaagttaaacctggcttgaaaatgaaagatttt
aatatttttaataccatcgatcgcttaaaagtggagggagatttgtttaaaggtgtactg
ggcaagggaattgatttaatgaaggccattgataaagccaaaagtgtttttggataa

DBGET integrated database retrieval system