KEGG   Sphingobacteriaceae bacterium GW460-11-11-14-LB5: CA265_15710Help
Entry
CA265_15710       CDS       T05546                                 

Definition
(GenBank) alpha-glucosidase
  KO
K21574  glucan 1,4-alpha-glucosidase [EC:3.2.1.3]
Organism
sbx  Sphingobacteriaceae bacterium GW460-11-11-14-LB5
Pathway
sbx00500  Starch and sucrose metabolism
sbx01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sbx00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    CA265_15710
Enzymes [BR:sbx01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     CA265_15710
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_97 GH97_N GH97_C Big_5
Motif
Other DBs
NCBI-ProteinID: ARS41021
UniProt: A0A1X9Z7W8
LinkDB All DBs
Position
complement(3960016..3962160)
Genome map
AA seq 714 aa AA seqDB search
MNKKLNQFFNRFAILTLICTVLFFGNAFGNVPGEDLKSPDGNLVVSFALAEGGVPTYSLK
YKGKDVIKTSKLGLELKDGKSLLDGFTITDTKTSAFNETWKPVWGEVKEIVNHYNELAVT
LTQKETNRYIIVRLRLFNDGLGFRYEFPEQKNLAYFVIKEEKTQFALAGDHKAFWLPGDY
DTQEYSTVTSNLSEVRGKMKAAVTPNASQTTFSPTGLQTPLMMKSKDGLYINIHEAALIN
YSLMSLNLDDKNMVLESWLTPDAIGDKGYMQAPCLSPWRTIIVSDKAGDILTSKLTYNLN
EATKFKDVSWIKPTKYVGVWWEMITGKSTWAYNDLTSVQLGVTDYAKTKPNGKHAANTAH
VKEYIDFAAKNGLDAVLVEGWNEGWEDWFGKTKDDVFDFVTPYPDFDVKELHRYAASKGI
KMIMHHETSSSVRNYERHLDTAYKFMKANGYDAVKSGYVGNMIPRGEHHYGQWLNNHYLY
AIQKAAEYKIMVNAHEAVRPTGLARTYPNLIGNESARGTEYEAFGGNNADHTTILPFTRL
IGGPMDYTPGIFETKVSVYNPENISFVHSTLARQLALYVTMYSPLQMAADLPETYNKYMD
AFQFIKDVAVDWDDTKVLEAEPGDYITFARKAKGKNNWFVGRTNDEVARTSKIDFSFLDP
GKKYTATIYADAKDAHYETNPKAYTIRKMEVSNKTKLSQYCAPGGGYAISIMAK
NT seq 2145 nt NT seq  +upstreamnt  +downstreamnt
atgaataaaaaactaaaccaattctttaaccgctttgcaatccttactttaatatgcact
gtgcttttttttgggaatgctttcgggaacgttcccggtgaggatttgaagtcgccggat
ggtaatctggtggtcagctttgccttggctgaagggggagtacctacctatagcttaaag
tacaaaggaaaagacgtgataaaaaccagcaaactggggcttgaacttaaagatggtaaa
tcgttactggatggtttcactattactgatactaaaaccagtgcatttaacgaaacctgg
aaaccagtttggggagaggtaaaagaaattgtaaatcattataacgaactggcggtaact
ttaacacaaaaagaaactaatcgttatattattgtgcgtttacgcctgtttaacgatggt
ttgggttttagatatgaattccctgagcaaaagaatttagcttactttgttattaaagaa
gagaaaacgcagtttgccctggctggcgatcataaagcattttggcttccgggcgattat
gatacacaggaatacagtacagtaacgtcaaacttatcagaagtgcgtggtaaaatgaag
gccgcggtaacaccaaatgcatcgcagaccactttttcgccaaccggtttacaaacgcct
ttgatgatgaagagtaaagatggtttatacatcaatatccatgaggcagcactgatcaat
tattctttaatgtcgttaaatcttgatgacaaaaatatggttttagaatcgtggttaacg
cctgatgccattggcgataaaggttatatgcaggcgccttgtttatcgccctggagaacc
attatcgtgagcgataaagcaggtgatattttgacctcaaaattaacctataacttaaac
gaagcaacaaaatttaaagatgtatcgtggataaaaccaaccaagtacgtgggtgtttgg
tgggaaatgattactggcaaaagtacctgggcctataatgatttaaccagtgttcaatta
ggtgtaaccgattatgcaaaaactaaacctaatggaaaacacgctgcaaataccgcacat
gtaaaagagtacatcgattttgctgctaaaaacggattggatgcggtgttggttgaaggc
tggaacgaaggctgggaagattggttcggtaaaacaaaggatgatgtttttgattttgta
acgccctatcccgatttcgatgtaaaagaactgcaccgttacgcggcgagcaaaggcatt
aaaatgataatgcaccacgaaacttcttcatcggtaaggaactacgaacgccatttggat
acggcttataaatttatgaaagccaatggatatgatgccgttaaaagtggttatgtaggc
aacatgatcccaagaggagagcatcactatgggcaatggctaaacaatcattacctgtat
gccatccaaaaggctgctgagtataaaattatggtgaatgcacacgaagcggttcgcccg
acaggcctggcacgtacttaccctaacttaattggaaacgaatcggccagaggaacagaa
tacgaagcttttggtggcaacaatgccgatcatactacaattttgccctttacacgttta
attggcggaccgatggattatacccctggtattttcgaaaccaaagtaagtgtttataat
cctgaaaatatttcatttgtacacagtacactggcccgccagctggcgctttatgttacc
atgtatagtccattgcagatggctgccgatttgcctgaaacgtataataagtacatggat
gcttttcagtttattaaagatgtggcagtagattgggacgataccaaagttttagaagca
gaacctggtgattatattacttttgcgcgtaaggcgaaaggtaaaaacaattggtttgtt
ggccgcaccaatgatgaggtagcccgaacctctaaaatcgattttagctttttagatcca
ggtaaaaaatacacggcaaccatttatgccgatgctaaagatgctcattatgaaaccaat
cctaaagcctataccattcgtaaaatggaggtaagcaataaaacgaaattatcgcagtat
tgtgcacctggtggaggatatgcgattagtattatggcgaaataa

DBGET integrated database retrieval system