KEGG   Sphingobacteriaceae bacterium GW460-11-11-14-LB5: CA265_21350Help
Entry
CA265_21350       CDS       T05546                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
sbx  Sphingobacteriaceae bacterium GW460-11-11-14-LB5
Pathway
sbx00620  Pyruvate metabolism
sbx00680  Methane metabolism
sbx01100  Metabolic pathways
sbx01120  Microbial metabolism in diverse environments
sbx01200  Carbon metabolism
Module
sbx_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:sbx00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    CA265_21350
  09102 Energy metabolism
   00680 Methane metabolism
    CA265_21350
Enzymes [BR:sbx01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     CA265_21350
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2 DUF2121
Motif
Other DBs
NCBI-ProteinID: ARS42064
UniProt: A0A1X9ZB68
LinkDB All DBs
Position
5265861..5268446
Genome map
AA seq 861 aa AA seqDB search
MPKLRLTTQRESIFNNEVISKFELFNSLFLTLPFYKIKDTGTLLPLFFKSCEEGIANGEK
PAQIIEEFFAKYTSYTERKDIVDLLFRFIQYIERQVVLFDAVEDASFTKLNTTDEQSTLA
FILKKNADNKPVLSKIEKLIDELSLRLVLTAHPTQFYPGSVLAIITDLTKAIRDNDLTSM
NSLLQQLGKTPFFNKKSPTPVDEALNLAWFLENTFYFAAANIQEEIDQNLDEYNLETKKI
LELGFWPGGDRDGNPNIHADTTLEVSKMLRQILFRCYYRDFRVIKRRITFRGVEENIAKL
HDVLYLNAFDQTCELHDISNELRDNLNKIKETLLAEHDGLFVDLVNDLIRKIDLYGNYFA
SLDIRQDSRVLRNVHAYCRANKPISSLYPADYDKLSEAEKLALISFKEATIVYASEPDAL
TKDTIEVIKEIKGIQSRNGEKACHRFIISNCQQASDILQLIELFLWNGWSKESLTIDFVP
LFETVNDLKGAAAIMETLYSNPFYKAHLASRGNKQHIMLGYSDSTKDGGYLMANWSIFNG
KTSLSAVAAKHNIQLAFFDGRGGPPARGGGKTHRFYASMGKEIANKNMQLTVQGQTISSQ
YGSVESAEFNIEQLINAGLTSGLKEKHNILLDPENKTLLDEMAEESYKVFVDLREHPLFV
SYLEKLSPLKLLSQANISSRPVKRNGGGEMKLEDLRAISFVTAWSMLKQNVPGFYGMGTA
LKNQEKAGNWDKVVKVYQDSDYLKTIVDNCMMSMSKSDFTITAHLAADKEFGAFWTQLHN
EFELAKEMLLKLSGQPTLMANYPVDKKSIATREKIILPLVLIQHFALEKLQHNQNEKDQQ
ALEKLAVRTVFGIVNAGRNLA
NT seq 2586 nt NT seq  +upstreamnt  +downstreamnt
atgcctaaacttcgtttaactacgcaacgagaatctatttttaataatgaggtcatctca
aaattcgaactatttaacagtttatttctcaccttgcctttttacaaaattaaagacacc
ggaaccctgcttccgctattttttaagagctgtgaagaaggcattgcaaacggagaaaaa
cctgcacagattatcgaagaatttttcgccaagtataccagttataccgagcgcaaagat
attgttgacctgctctttcgttttatccagtatatcgaacgtcaggtggtactctttgat
gccgtagaagatgcttcttttaccaaactcaatacgactgacgagcagagtacactggca
ttcatcttaaaaaagaatgccgataacaaacccgtgttatcaaaaattgagaaattgatt
gatgaactttcgcttcgtttagttctaactgcacacccaacccagttttatccgggaagt
gtattggccattattaccgatttaaccaaagccattcgtgataacgaccttacttcgatg
aactcgttattgcagcaattgggtaaaacgccgttttttaataaaaaatcgccaacaccg
gttgatgaggccttaaaccttgcctggttcctggagaatacattttactttgctgctgcg
aacatacaggaagagatcgatcagaacctggatgaatacaacctggaaaccaagaaaatt
ttagagctgggtttctggccaggaggcgatagagacggaaatccgaacattcatgccgat
accaccctggaggtttctaaaatgttgcgccagatcctgttccgttgttattaccgcgat
ttcagggtaattaaacgccgcattacttttagaggcgttgaagagaatatcgcaaaacta
catgatgtattgtatctgaatgctttcgatcaaacttgcgagctccatgatatttctaac
gagttaagggataacctaaataaaattaaggaaacattgctggccgaacacgatggttta
tttgttgatttggttaacgatctgatccgtaaaatagatttgtatggcaactactttgct
tcacttgatatccgtcaggatagccgtgtgctgaggaatgtacatgcttactgccgcgcc
aataaaccaatatcttctttatatcctgctgattatgataagctatcagaagcagagaaa
ttagctttaatttcttttaaagaggcaaccattgtttacgcaagcgagcccgatgccctg
acaaaggatacaatcgaagtaatcaaagaaattaaaggcattcaaagccgtaatggtgaa
aaagcctgtcaccgttttattatcagtaattgccagcaagcaagcgatattttgcaattg
attgagcttttcctttggaatggctggagtaaagaatccttaacgattgattttgtgccg
ctttttgaaacggttaacgatttaaaaggagccgcggcaattatggaaacgctttacagt
aatccattttataaagcccatttggccagccgtggaaataaacagcatattatgcttggt
tattctgacagtaccaaagatggtggttatttaatggccaactggtctatttttaacgga
aaaacctctctatcggctgttgctgcaaaacataatattcaattggccttttttgatggc
cgtggaggaccgcctgcacgtggcggaggtaaaacacaccgtttttacgcttcaatgggt
aaagaaattgccaataaaaacatgcagttaaccgttcagggacagacaattagttcacaa
tacggatctgtagaaagtgcagaatttaatatcgaacaattaatcaatgccggattaacc
tctggattgaaagagaaacacaatattcttttagatcctgaaaataaaaccctgcttgat
gagatggctgaagaaagttataaggtttttgtcgatttgcgtgagcatccgttatttgtg
agttatttagaaaaattgtctcctttaaaacttttgtcgcaggcgaacattagtagtcgt
ccggtaaaaagaaatggtgggggtgagatgaaactcgaagatttaagggctattagtttt
gttacggcctggagtatgctgaaacaaaacgttcctggtttttatggaatgggaacagcg
ttgaaaaaccaggaaaaagctggtaattgggataaagtagttaaagtttaccaggactct
gattacctgaaaaccattgtagataactgtatgatgagtatgagcaaatcagactttacc
attacggcgcatttagccgcagataaagaatttggtgctttttggactcaactacacaac
gaattcgaattagcgaaggagatgcttttaaaactctccggacagccaacattaatggcg
aattatccggtagataaaaaatcgatcgccacccgcgaaaaaattattttaccactggta
ctcattcagcattttgctttagagaaactgcagcacaatcagaacgagaaagaccagcag
gctttagaaaagcttgcagtaagaacggtatttggtattgtaaatgcaggtaggaattta
gcttaa

DBGET integrated database retrieval system