KEGG   Salmonella bongori N268-08: A464_124Help
Entry
A464_124          CDS       T02733                                 

Definition
(GenBank) UDP-N-acetylmuramate--alanine ligase
  KO
K01924  UDP-N-acetylmuramate--alanine ligase [EC:6.3.2.8]
Organism
sbz  Salmonella bongori N268-08
Pathway
sbz00471  D-Glutamine and D-glutamate metabolism
sbz00550  Peptidoglycan biosynthesis
sbz01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sbz00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    A464_124
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    A464_124
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:sbz01011]
    A464_124
Enzymes [BR:sbz01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.8  UDP-N-acetylmuramate---L-alanine ligase
     A464_124
Peptidoglycan biosynthesis and degradation proteins [BR:sbz01011]
 Precursor biosynthesis
  Amino acid ligase
   A464_124
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mur_ligase Mur_ligase_M Mur_ligase_C
Motif
Other DBs
NCBI-ProteinID: AGR57310
UniProt: S5N4G5
LinkDB All DBs
Position
131276..132751
Genome map
AA seq 491 aa AA seqDB search
MNTQQLAKLRSIVPEMRRVRHIHFVGIGGAGMGGIAEVLANEGYQISGSDLAPNPVTQQL
TSLGATIFFNHRPENVRDASVVVVSSAISADNPEIVAAHEARIPVIRRAEMLAELMRFRH
GIAIAGTHGKTTTTAMVSSIYAEAGLDPTFVNGGLVKAAGVHARLGHSRYLIAEADESDA
SFLHLQPMVAIVTNIEADHMDTYHGDFENLKQTFINFLHNLPFYGRAVMCVDDPVIRELL
PRVGRQTTTYGFSDDADVRVEDYQQAGPQGHFTLLRQGMPDLRVTLNAPGRHNALNAAAA
VAVATEEGIEDDAILRALESFQGTGRRFDFLGEFPLEPVNGKAGTAMLVDDYGHHPTEVD
ATIKAARAGWPEKNLVMLFQPHRFTRTRDLYDDFANVLTQVDALLMLDVYPAGETPIPGA
DSRSLCRTIRNRGKIDPILVSDPAQVATMLAPVLTGNDLILVQGAGNVGKIARYLSEIKL
KPQIQEEEQHG
NT seq 1476 nt NT seq  +upstreamnt  +downstreamnt
atgaatacacaacaactggcaaaactgcgttccatcgtgcccgaaatgcgtcgcgttcgg
cacattcactttgtcggcatcggtggtgccggtatgggcggtattgccgaagttctggct
aatgaaggctatcagatcagtggttccgacttagcgccgaatccggtgacccagcagtta
acgagcctgggggcgacgattttctttaaccatcgcccggaaaatgtgcgcgatgccagc
gtggtggtggtttccagcgcgatctctgcggataacccggagattgtggcggcgcatgaa
gcgcgtattccggtcattcgccgcgcggaaatgctggcggagctgatgcgctttcgtcac
ggcatcgccattgccgggactcatggaaaaaccacgaccaccgcgatggtatccagtatt
tatgctgaggcggggttggacccgactttcgtgaatggcggactggtaaaagccgcaggc
gttcatgcgcgtctgggccatagccgttacctgattgccgaggcggatgagagcgatgcg
tcgtttctgcacctgcagccgatggtcgcgattgtcaccaatatcgaagctgaccatatg
gatacctatcatggcgactttgaaaatttaaagcagacgtttattaactttctgcacaat
ctgcccttttatggccgcgcagtaatgtgtgttgacgatccggtcatccgtgagctgttg
ccgcgtgtggggcgtcagacgacgacctacggttttagtgatgatgccgacgtgcgggta
gaagattatcagcaggcggggccgcagggacactttacgctgttgcgccaggggatgccg
gatctgcgcgtgacattgaacgcgccgggtcgtcacaatgccctgaacgccgcggcagcg
gtcgcagtggcgacggaagaaggtattgaagatgatgctatcctgcgcgcgctggaaagc
ttccagggcaccgggcgtcgctttgatttcctcggcgagtttccgcttgaaccggtaaac
ggtaaagccggtacggcgatgttggtggatgactatggccatcatccaacggaagtggat
gcgacgattaaagccgcgcgggcgggatggccggaaaaaaatctggtgatgctgtttcag
ccgcaccgtttcacgcgtacgcgcgacctctatgatgatttcgccaatgtgttgacgcag
gtagatgcgctgctcatgctggacgtttatccggcaggcgaaacaccgattccgggggca
gatagccgctcgttatgccgtacgattcgcaatcggggaaaaattgacccgattctggtt
tccgatccggctcaggttgcgacaatgttagcgccagtgcttacgggcaacgacttgata
ttggtgcaaggcgcaggaaatgttggcaaaattgcgcgttacttatctgaaatcaagcta
aagccgcaaattcaggaggaagagcaacatggctga

DBGET integrated database retrieval system