KEGG   Salmonella bongori N268-08: A464_1566Help
Entry
A464_1566         CDS       T02733                                 

Definition
(GenBank) Starvation sensing protein RspB
Organism
sbz  Salmonella bongori N268-08
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C HI0933_like AlaDh_PNT_C DAO Pyr_redox_2 TrkA_N Pyr_redox_3 Pyr_redox ADH_zinc_N_2 NAD_binding_8
Motif
Other DBs
NCBI-ProteinID: AGR58752
UniProt: S5NEU0
LinkDB All DBs
Position
complement(1559738..1560763)
Genome map
AA seq 341 aa AA seqDB search
MKVKAVYINKPGEVETRWVEYPRKKENEVLIKVDAAGICGSDIGAFRGTNPLVTYPRIIG
HEVTGIVLQKGAGMPDNIQEGDRVIVDPYIYCGHCYPCSVGRTNCCENLKVIGVHVDGAM
REVVSHPAHLIHKIPDNVPSEMAPLAEPLTIALHALHRANVKAGEHVAIIGAGAIGLMAA
LSARHYKATPVLIDIVEERLRYAHKLGVPYVLNATDGQVIDAIKDITHGTMAQVVIEASG
ANSAIRNTLDLASFAGRISFTGWPKQETLLPTNLITYKELDLRGSRTSAGEFDEALRMLS
TLEINPQDVVSKVVNLDEIPDAVRELDRYPERYLKINAVFQ
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtcaaagctgtgtacattaataaacctggtgaagttgaaacccgttgggtggag
tatccgcgtaagaaagagaatgaagttttaattaaagttgatgccgcaggaatttgcgga
tcggatatcggggcttttcgtggaacgaatccccttgtcacttacccacgcattatcggc
catgaagtgaccggaattgttcttcagaaaggcgcaggaatgccggacaatattcaggaa
ggcgaccgcgtgattgttgacccttatatttattgtggtcactgctacccttgctctgtt
ggcagaacgaactgttgtgaaaatttaaaagtcattggtgtacatgttgatggcgcaatg
cgggaagtcgtttctcatcccgcacatttaattcataaaattcctgacaacgtaccttct
gaaatggcaccgctggcagaaccgctcacaattgcgttgcacgcgttgcatcgggcaaat
gttaaggccggggaacatgttgctatcatcggcgccggcgccattggtcttatggcggca
ttaagcgcgcgtcattacaaggcaacgcctgttctgattgatattgtggaagaacggcta
cgctatgctcacaaactcggcgttccctatgtgctaaatgctaccgacggtcaggttatc
gacgccattaaagacattacccatggcaccatggcgcaggttgttatagaagcctccggt
gccaatagcgctattcgaaatacgcttgatttagcatcgtttgctggccgtatttctttt
acaggatggccaaaacaggaaacattgctgccgacaaatctgatcacttataaagaactg
gatttacgcgggtcccgtaccagtgccggtgaatttgacgaggcattacgaatgctgtcc
acgctggaaattaacccacaagacgttgtcagtaaggttgtcaatctggatgagatccct
gatgcggtgagagagcttgatcgttatccggaacgctacttaaaaatcaatgctgttttc
cagtga

DBGET integrated database retrieval system