KEGG   Salmonella bongori N268-08: A464_2446Help
Entry
A464_2446         CDS       T02733                                 

Definition
(GenBank) Aspartate/tyrosine/aromatic amino transferase
  KO
K14260  alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
sbz  Salmonella bongori N268-08
Pathway
sbz00220  Arginine biosynthesis
sbz00250  Alanine, aspartate and glutamate metabolism
sbz00290  Valine, leucine and isoleucine biosynthesis
sbz01100  Metabolic pathways
sbz01110  Biosynthesis of secondary metabolites
sbz01130  Biosynthesis of antibiotics
sbz01210  2-Oxocarboxylic acid metabolism
sbz01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:sbz00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    A464_2446
   00290 Valine, leucine and isoleucine biosynthesis
    A464_2446
   00220 Arginine biosynthesis
    A464_2446
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:sbz01007]
    A464_2446
Enzymes [BR:sbz01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     A464_2446
    2.6.1.66  valine---pyruvate transaminase
     A464_2446
Amino acid related enzymes [BR:sbz01007]
 Aminotransferase (transaminase)
  Class I
   A464_2446
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 DegT_DnrJ_EryC1 Aminotran_5 Aminotran_MocR Beta_elim_lyase
Motif
Other DBs
NCBI-ProteinID: AGR59631
UniProt: S5MSF7
LinkDB All DBs
Position
2432329..2433543
Genome map
AA seq 404 aa AA seqDB search
MSPIEKSSKLENVCYDIRGPVLKEAKRLEEEGNKVLKLNIGNPAPFGFEAPDEILVDVIR
NLPTAQGYCDSKGLYSARKAIMQHYQARGMRDVTVEDIYIGNGVSELIVQAMQALLNSGD
EMLVPAPDYPLWTAAVSLSGGNAVHYLCDESSDWFPDLDDIRAKITPRTRGIVIINPNNP
TGAVYSKELLMEIVSIAREHNLIIFADEIYDKILYDDAEHHSIAALAPDLLTVTFNGLSK
TYRVAGFRQGWMVLNGPKKHAKGYIEGLEMLASMRLCANVPAQHAIQTALGGYQSISEFI
LPGGRLYEQRNRAWELINDIPGVSCVKPRGALYMFPKIDAKRFTIHDDQKMVLDFLLQEK
VLLVQGSAFNWPWPDHFRIVTLPREDDLEMAINRFGRFLSGYHQ
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgtcccccattgaaaaatccagcaaactcgaaaatgtctgttatgacatacgtggcccc
gttctgaaagaagcgaaacgcctggaagaagaaggtaataaagttcttaaactgaatatc
ggtaaccccgcccccttcggattcgaagcgccggacgaaattctggtcgatgtcattcgt
aatctgccgacagcgcaaggctattgcgactcgaaagggctctattccgcccgtaaagca
attatgcagcattaccaggcccggggaatgcgcgatgtgaccgtggaagatatttatatt
ggtaatggtgtttccgaactgatcgttcaggcgatgcaagcgttgcttaacagcggcgat
gaaatgctggttcctgcgcccgattatccgttgtggacagcagcggtatcgctctccggc
ggtaacgcagtacactatctttgtgatgaatcttccgactggttcccggaccttgacgat
atccgcgccaaaattaccccgcgtacgcgtggcattgtgattattaatccaaacaaccct
accggcgccgtttattctaaagaattgttgatggaaattgttagcattgcgcgcgagcat
aatctcatcatcttcgccgatgaaatttatgacaagatcctctacgacgatgccgaacat
cactccatcgccgcactggcgccggacctgttgaccgtcacctttaatggtttgtctaaa
acctatcgtgttgccggttttcgccagggctggatggtattaaacgggcctaaaaaacat
gcgaagggttatatcgaaggcctggagatgttggcttcaatgcgcctgtgcgccaatgtc
ccggcgcaacatgccattcagaccgcgctcggcggttatcaaagcattagtgaatttatc
ctgcctggtggccgtctgtatgaacagcgtaaccgcgcctgggagttgattaacgatatt
cccggcgtctcctgtgtaaaaccgcgcggcgcgttatacatgttcccgaagatcgacgct
aaacgctttactatccatgatgaccagaagatggtgctggatttcctgctacaggaaaaa
gtgctactggtgcaaggcagcgcctttaactggccgtggccggaccacttccgtattgtg
acactaccgcgtgaagatgacctagagatggctatcaaccgctttgggcgttttctctca
ggctaccatcaataa

DBGET integrated database retrieval system