KEGG   Salmonella bongori N268-08: A464_2501Help
Entry
A464_2501         CDS       T02733                                 

Definition
(GenBank) Enoyl-CoA hydratase
  KO
K01782  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
sbz  Salmonella bongori N268-08
Pathway
sbz00071  Fatty acid degradation
sbz00280  Valine, leucine and isoleucine degradation
sbz00281  Geraniol degradation
sbz00310  Lysine degradation
sbz00362  Benzoate degradation
sbz00380  Tryptophan metabolism
sbz00410  beta-Alanine metabolism
sbz00640  Propanoate metabolism
sbz00650  Butanoate metabolism
sbz00903  Limonene and pinene degradation
sbz00930  Caprolactam degradation
sbz01100  Metabolic pathways
sbz01110  Biosynthesis of secondary metabolites
sbz01120  Microbial metabolism in diverse environments
sbz01130  Biosynthesis of antibiotics
sbz01200  Carbon metabolism
sbz01212  Fatty acid metabolism
Module
sbz_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:sbz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    A464_2501
   00650 Butanoate metabolism
    A464_2501
  09103 Lipid metabolism
   00071 Fatty acid degradation
    A464_2501
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    A464_2501
   00310 Lysine degradation
    A464_2501
   00380 Tryptophan metabolism
    A464_2501
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    A464_2501
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    A464_2501
   00281 Geraniol degradation
    A464_2501
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    A464_2501
   00930 Caprolactam degradation
    A464_2501
Enzymes [BR:sbz01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     A464_2501
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     A464_2501
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     A464_2501
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2
Motif
Other DBs
NCBI-ProteinID: AGR59686
UniProt: S5MSK3
LinkDB All DBs
Position
complement(2480059..2482206)
Genome map
AA seq 715 aa AA seqDB search
MTTPSAFTLNVRPDNVAVVAIDVPGEKMNTLKTEFAAQVRALLKQIRENKTLQGVVFISA
KADNFIAGADINMIDACQSAQEAETLARQGQQLMAEIQALPVPVIAAIHGACLGGGLEMA
LACHRRICTDDAKTVLGLPEVQLGLLPGSGGTQRLPRLVGISTALDMILTGKQLRARQAL
KTRLVDDVVPQSILLEAAVELAKKERLAQRRLPVRERILAGPLGRALLFRLVRKKTAQKT
QGNYPATERIIDVIETGLAQGSSSGYDAEARAFGELAMTPQSQALRAIFFASTQVKKDPG
SDAPPGPLHSVGILGGGLMGGGIAWVTACKGGLPVRIKDINAKGINHALKYSWDQLETKV
RRRHIKASQRDKQLSLISGSTDYRGFSHRDVVIEAVFEDLALKQQMVAEVEQHCAPHTIF
ASNTSSLPISDIAANAARPQQVIGLHFFSPVEKMPLVEVIPHASTSAQTIATTVQLAKKQ
GKTPIVVSDKAGFYVNRILAPYINEAIRMLTEGERIEHIDTALVKFGFPVGPIQLLDEVG
IDTGTKIIPVLEAAYGERFSAPANVVASILNDDRKGRKNGRGFYLYGKKGRKSKKQVDPA
IYKLINVQGQSRLSAQQVAERCVMLMLNEAARCFDERVIRSARDGDIGAVFGIGFPPFLG
GPFRYMDTLGAGEVVAALRRLATLYGPRYAPCEQLVRMAERREYFWTNEETDQRK
NT seq 2148 nt NT seq  +upstreamnt  +downstreamnt
atgacgactccatcagcttttacgcttaacgtgcgcccggataatgtcgcggttgtcgct
atagatgtccctggggaaaagatgaacaccctgaaaacggagtttgccgctcaggtacgt
gcccttctgaagcagatccgggaaaataaaacgttacaaggcgtcgtttttatctcggct
aaggcggataactttattgctggcgccgatatcaacatgatagatgcctgtcaaagcgcg
caagaggcggaaacgctggcgcgtcaagggcagcaactgatggcggagattcaggcattg
cctgttccggtcatcgccgccattcacggagcctgtctggggggcggactcgaaatggcg
ctggcctgtcaccggcgtatctgtactgatgatgctaaaaccgttctcggcctgccggaa
gtgcagttagggcttttacccggatcagggggaacgcaacgacttccacggctggtgggg
atcagtaccgcgttggatatgatcctgacggggaagcagcttcgtgccagacaggcgctg
aagactaggctggttgatgacgtggtaccacagtccattttactggaagcggcggttgag
ctggctaaaaaagaacgtctggcgcagcggagattacccgtacgcgagcgtatcctggcg
ggcccgttggggcgcgcgctgctatttcgcctggtgcgtaaaaagacagcgcaaaaaacg
cagggtaattatcctgcaacagaacgaatcattgacgtgattgaaaccggactggcgcag
ggaagcagtagtggttatgacgcggaagcccgcgctttcggcgagctggcgatgacgcct
caatcgcaggcgctgcgcgctattttctttgccagcacccaggtgaaaaaagatcccggt
agcgatgcgccgcccggcccgctgcatagcgtaggcatattgggcggcggattaatgggc
ggcggtatcgcctgggtcaccgcctgtaaaggcggcttgccagtacgcattaaggatata
aatgctaagggaatcaaccatgcactgaagtacagctgggatcaacttgaaactaaagta
cgccgacgccatatcaaagccagtcaacgtgataaacaactgtcattgatttcaggctcg
accgattatcgcggttttagtcatcgcgacgtggtaattgaagcagtatttgaagatctg
gcgttaaaacaacagatggtggcggaagtggaacaacattgcgcccctcacactattttc
gcctccaatacgtcttccttgccgattagcgatattgcggcaaacgcggccagaccgcag
caggtgattggactgcacttttttagcccggttgaaaaaatgccgctggttgaggtcatt
ccccacgcgtctacttccgcgcagacgatcgctacgaccgttcaactggcgaaaaaacag
ggtaaaaccccgatagtcgtcagtgataaagccggtttttatgttaaccgaatattggcg
ccgtacatcaacgaggcgattcgtatgctcaccgaaggggaacgtatcgaacatattgat
accgcgctggtaaaatttggttttccggtagggccaatccaacttttggatgaggtagga
atcgacacgggcactaaaattattcctgtgcttgaggcggcgtatggagaacgttttagc
gcgcctgcaaatgttgttgcttcaattttgaatgacgatcgcaaaggtagaaaaaatggt
cgcggtttctatctttatggcaaaaaagggcgtaaaagcaaaaaacaggttgaccctgct
atttataagcttattaacgtgcaagggcagagtcgactatctgcacagcaggtggcggag
cgctgtgtcatgttaatgctcaatgaagcggcacgctgtttcgacgaaagggtgattcgc
agtgcgcgcgatggtgatatcggcgctgtatttggtattggttttccgccgtttcttggc
ggcccgttccgttatatggatacgcttggcgcgggtgaagtagtggcggcgttgcggcgc
ctggctacgttatacgggccccggtacgcgccgtgtgagcaactggtgcgcatggcggag
cgcagggagtatttctggacgaatgaggaaactgaccagagaaaatga

DBGET integrated database retrieval system