KEGG   Salmonella bongori N268-08: A464_337Help
Entry
A464_337          CDS       T02733                                 

Definition
(GenBank) D-alanine--D-alanine ligase A
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
sbz  Salmonella bongori N268-08
Pathway
sbz00473  D-Alanine metabolism
sbz00550  Peptidoglycan biosynthesis
sbz01100  Metabolic pathways
sbz01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:sbz00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    A464_337
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    A464_337
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    A464_337
Enzymes [BR:sbz01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     A464_337
Peptidoglycan biosynthesis and degradation proteins [BR:sbz01011]
 Precursor biosynthesis
  Amino acid ligase
   A464_337
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp CPSase_L_D2 ATP-grasp_3 ATP-grasp_4 ATPgrasp_ST RimK GARS_A
Motif
Other DBs
NCBI-ProteinID: AGR57523
UniProt: S5MSG8
LinkDB All DBs
Position
complement(367807..368901)
Genome map
AA seq 364 aa AA seqDB search
MAKLRIGIVFGGKSAEHEVSLQSAKNIVEAIDKTRFDVVLLGIDKAGQWHVNDAENYLQN
ADDPAHIALRPSEMSLAQVPGKHEHQLINARNGQPLPTVDVIFPIVHGTLGEDGSLQGML
RVANLPFVGSDVLSSAACMDKDVAKRLLRDAGLNIAPFITLTRTNRHAFSFAEVESRLGL
PLFVKPANQGSSVGVSKVANEAQYHQAVALAFEFDHKVVVEQGIAGREIECAVLGNDRPQ
ASTCGEIVLNSEFYAYDTKYIDDNGAQVVVPAQIPSEVNDKIRAIAIQAYQTLGCAGMAR
VDVFLTADNEVVINEINTLPGFTNISMYPKLWQASGLSYTDLISRLIELALERHTADNAL
KRTM
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
atggcgaaattgcggataggaatagtatttggtggtaaatcagcagaacatgaagtgtct
ttgcaatcggcgaaaaatatcgttgaggcaatagataaaactcgctttgacgtagtgcta
ttagggatagataaagcgggacagtggcatgttaacgatgcggaaaattatttacagaat
gccgacgatccggcacatatcgcgctacgcccttcggaaatgagtcttgcccaggtgcca
ggcaaacatgagcaccaattgatcaacgcccggaacggtcagccgctaccgacggtagat
gtgattttccccatcgtccacggtacgttaggtgaagacggctcattgcaaggcatgcta
cgcgtcgcaaacttaccgtttgtcggttcagacgtcctgagttccgcggcctgcatggat
aaagacgttgccaaacgactgctgcgcgatgcaggtctgaatatcgccccgtttattacc
ctcacccgaacgaatcgtcacgcgtttagttttgccgaggttgaatctcgtctgggcctg
ccgctgttcgttaaacctgccaaccagggatcttcggtcggtgtcagtaaagtcgccaat
gaagcgcagtaccatcaggcggtcgcgctggccttcgaattcgatcataaagttgtagtc
gaacaagggatcgctggccgcgagatcgaatgcgccgtattaggtaacgatcgcccgcag
gccagtacctgtggtgaaatcgtgctgaatagcgaattttacgcctacgataccaaatac
attgatgataatggcgctcaggttgtggtaccggcgcaaataccttccgaggtgaacgac
aagatccgcgcgatcgcgatccaggcttatcagacgctgggctgcgcaggtatggcgcgt
gtcgatgtctttttaacggcagataatgaggtggtgatcaacgagatcaatacgctgcct
ggttttaccaatatcagcatgtatccaaaactctggcaggcgagcggattgagttatact
gatttgatcagccgcctgattgaactggcgctggaacgccatacggcggataacgcctta
aaaaggacgatgtaa

DBGET integrated database retrieval system