KEGG   Salmonella bongori N268-08: A464_3520Help
Entry
A464_3520         CDS       T02733                                 

Definition
(GenBank) Translation elongation factor Tu
  KO
K02358  elongation factor Tu
Organism
sbz  Salmonella bongori N268-08
Brite
KEGG Orthology (KO) [BR:sbz00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:sbz03012]
    A464_3520
   03029 Mitochondrial biogenesis [BR:sbz03029]
    A464_3520
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sbz04147]
    A464_3520
Translation factors [BR:sbz03012]
 Eukaryotic Type
  Elongation factors
   A464_3520
 Prokaryotic Type
   A464_3520
Mitochondrial biogenesis [BR:sbz03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    A464_3520
Exosome [BR:sbz04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   A464_3520
  Exosomal proteins of breast cancer cells
   A464_3520
  Exosomal proteins of colorectal cancer cells
   A464_3520
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 cobW
Motif
Other DBs
NCBI-ProteinID: AGR60704
UniProt: S5N1F1
LinkDB All DBs
Position
complement(3479825..3481009)
Genome map
AA seq 394 aa AA seqDB search
MSKEKFERTKPHVNVGTIGHVDHGKTTLTAAITTVLAKTYGGAARAFDQIDNAPEEKARG
ITINTSHVEYDTPTRHYAHVDCPGHADYVKNMITGAAQMDGAILVVAATDGPMPQTREHI
LLGRQVGVPYIIVFLNKCDMVDDEELLELVEMEVRELLSQYDFPGDDTPIVRGSALKALE
GDAEWEAKIIELAGFLDSYIPEPERAIDKPFLLPIEDVFSISGRGTVVTGRVERGIIKVG
EEVEIVGIKETQKSTCTGVEMFRKLLDEGRAGENVGVLLRGIKREEIERGQVLAKPGTIK
PHTKFESEVYILSKDEGGRHTPFFKGYRPQFYFRTTDVTGTIELPEGVEMVMPGDNIKMV
VTLIHPIAMDDGLRFAIREGGRTVGAGVVAKVLG
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
gtgtctaaagaaaaatttgaacgtacaaaaccgcacgttaacgtcggtactatcggccac
gttgaccatggtaaaactaccctgaccgctgccatcactaccgtactggctaaaacctac
ggcggtgctgcccgcgcattcgaccagatcgataacgcgccggaagaaaaagcgcgtggt
atcaccatcaacacttctcacgttgaatatgacaccccgactcgccactacgcacacgta
gactgcccggggcacgccgactatgttaaaaacatgatcaccggtgctgcgcagatggac
ggcgcgatcctggttgttgctgcgactgacggcccgatgccgcagacccgtgagcacatc
ctgctgggtcgtcaggtaggcgttccgtacatcatcgtgttcctgaacaaatgcgacatg
gttgatgacgaagagctgctggagctggtagaaatggaagttcgtgaacttctgtctcag
tacgacttcccgggcgacgacacgccgatcgttcgtggttctgctctgaaagcgctggaa
ggcgacgcagagtgggaagcgaaaatcatcgaactggctggcttcctggattcttacatt
ccggaaccagagcgtgcgattgataagccgttcctgctgccgatcgaagacgtattctcc
atctccggtcgtggtaccgttgttaccggtcgtgtagagcgcggtatcatcaaagtgggc
gaagaagttgaaatcgttggtatcaaagagacgcagaagtctacctgtactggcgttgaa
atgttccgcaaactgctggacgaaggccgtgctggtgagaacgttggtgttctgctgcgt
ggtatcaaacgtgaagaaatcgaacgtggccaggtactggctaagccgggcaccatcaag
ccgcacaccaagttcgaatctgaagtgtacattctgtccaaagatgaaggcggccgtcac
actccgttcttcaaaggctaccgtccgcagttctacttccgtacgactgacgtgactggc
accatcgaactgccggaaggcgtagagatggtaatgccgggcgacaacatcaaaatggtt
gttaccctgatccacccgatcgcgatggacgacggtctgcgtttcgcaatccgtgaaggc
ggccgtaccgttggcgcgggcgttgtagctaaagttctgggctaa

DBGET integrated database retrieval system