KEGG   Salmonella bongori N268-08: A464_3601Help
Entry
A464_3601         CDS       T02733                                 

Definition
(GenBank) Aerobic glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
sbz  Salmonella bongori N268-08
Pathway
sbz00564  Glycerophospholipid metabolism
sbz01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sbz00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    A464_3601
Enzymes [BR:sbz01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     A464_3601
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C NAD_binding_8 FAD_oxidored Pyr_redox_2 3HCDH_N FAD_binding_2 Lycopene_cycl GIDA
Motif
Other DBs
NCBI-ProteinID: AGR60785
UniProt: S5NDQ3
LinkDB All DBs
Position
3565364..3566872
Genome map
AA seq 502 aa AA seqDB search
METKDLIVIGGGINGAGIAADAAGRGLSVLMLEAQDLACATSSASSKLIHGGLRYLEHYE
FRLVSEALAEREVLLKMAPHIAFPMRFRLPHRPHLRPAWMIRIGLFMYDHLGKRTSLPGS
TSVRFGADSVLKPEIVRGFEYSDCWVDDARLVLANAQMVVRQGGEVLTRTRATSARREKG
LWIVEAEDIDTGKKYIWQARGLVNATGPWVKQFFDEGMHLPSPYGIRLIKGSHIVVPRVH
NQKQAYILQNEDKRIVFVIPWMEEFSIIGTTDVEYKGDPKAVKIEESEINYLLKVYNAHF
QKQLGRDDIVWTYSGVRPLCDDESDSPQAITRDYTLDIHDENGKAPLLSVFGGKLTTYRK
LAEHAMEKLAPWYPGIGPAWTKTCVLPGGDIDGSREDYAAKLRRRYPFLTESLARHYSRT
YGSNTEWILGEATSLLDLGEDFGHEFYEAELKYLVDHEWVRRTEDAIWRRTKEGMWLTAE
QQSRITQWLAEYVGKRQLSLAS
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
atggaaaccaaagatctgatcgtgataggcgggggcattaacggtgcgggcatcgcggct
gatgccgccggacgcggtttgtctgtactcatgctggaagcacaggatttggcctgcgcg
acctcttccgccagttctaaacttatccacggcggcttacgctacctggaacactatgaa
tttcggctggtcagcgaagcgctggcagaacgtgaagtactgttgaaaatggcgccgcat
attgccttcccgatgcgctttcgtctgccgcatcgcccgcatttacgtccggcatggatg
attcgcattggtctgtttatgtacgatcacctgggaaaacgtaccagtttacccggctct
accagcgtgcgttttggcgcagattcggtgctgaaacccgaaatcgtgcgcggtttcgaa
tattcggactgctgggtagatgatgcccgtctggtgctggccaatgcgcagatggtggta
cgccagggcggggaagttcttacccgcacgcgtgcaacctccgctcgccgggagaagggt
ctgtggattgtcgaagcggaagatatcgataccggtaaaaaatatatctggcaggcgcgc
ggactggtcaacgcgaccgggccgtgggtcaaacagttcttcgacgaagggatgcacctg
ccgtcgccttatggcatccgcctgatcaaaggcagccatatcgttgtgccgcgcgtccat
aatcagaagcaggcgtatattctgcaaaacgaagataaacgaatcgtctttgtcatccca
tggatggaagagttttcgatcatcggcacaaccgatgttgaatataaaggcgatccgaaa
gcagtaaaaattgaagaaagtgaaattaattacctgttgaaggtttataacgcgcatttc
caaaagcaattgggacgcgatgacatcgtctggacatactccggcgtgcgtccgctgtgt
gatgatgagtctgactcaccgcaggctattactcgtgattacaccctggatatccacgat
gaaaacggcaaagcaccgctgctttccgtgtttggcggtaagctgacgacctaccgtaag
ctggccgaacacgcgatggaaaaactggcgccctggtatccaggcatcgggccggcatgg
accaaaacgtgcgtactgcccggcggcgacatcgacggcagccgcgaagattacgcggcc
aaactgcgtcgtcgttatccgttcctgacggaatcgctggcgcgccactattcgcgtact
tacggcagcaatacagagtggattctcggcgaagccacgtcactgcttgatttaggcgaa
gatttcggccatgagttttacgaagcggaactcaaatatctggtggatcacgaatgggtg
cgccgtactgaagacgctatctggcgacgcaccaaagaaggcatgtggctgaccgctgag
cagcagtcgcgcattacccagtggctggcggagtatgttggcaaacgccagctgtcgctg
gcgtcgtaa

DBGET integrated database retrieval system