KEGG   Salmonella bongori N268-08: A464_3640Help
Entry
A464_3640         CDS       T02733                                 

Definition
(GenBank) Gamma-aminobutyrate:alpha-ketoglutarate aminotransferase
  KO
K00823  4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
sbz  Salmonella bongori N268-08
Pathway
sbz00250  Alanine, aspartate and glutamate metabolism
sbz00410  beta-Alanine metabolism
sbz00640  Propanoate metabolism
sbz00650  Butanoate metabolism
sbz01100  Metabolic pathways
sbz01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:sbz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    A464_3640
   00650 Butanoate metabolism
    A464_3640
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    A464_3640
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    A464_3640
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:sbz01007]
    A464_3640
Enzymes [BR:sbz01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     A464_3640
Amino acid related enzymes [BR:sbz01007]
 Aminotransferase (transaminase)
  Class III
   A464_3640
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2 DUF1869 Beta_elim_lyase
Motif
Other DBs
NCBI-ProteinID: AGR60824
UniProt: S5N1R6
LinkDB All DBs
Position
complement(3612515..3613780)
Genome map
AA seq 421 aa AA seqDB search
MKSAELNHRRQQATPRGVGVMCDYFVEKAENATLWDVEGNEVIDFAAGIAVLNTGHRHPK
IVAAVEQQLQAFTHTAYQIVPYESYVSLAERINAIAPVDGPAKTAFFTTGAEAVENAVKI
ARAYTGRPGLITFGGGFHGRTFMTMALTGKVAPYKIGFGPFPGSVYHAVYPNAAHGVSVD
DALKSLERIFKADIAADQVAAIVLEPIQGEGGFNVAPAAFMQALRQLCDTHGILLIADEV
QTGFARTGKVFAMQHYAVKPDLMTMAKSLAGGFPLSGVVGRAEVMDAPAPGGLGGTYAGN
PLAVAAAHAVLDIIEEEQLCQRANQLGEHLQEVLNQARASCPAIADVRGLGSMVAVEFND
PQSGEPSAEYTRQVQRKAQENGLLLLSCGVYGNVIRFLYPLTIPDAQFSKALDILARVLR
A
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaagtgctgaactgaatcatcgtcgccagcaggcgactccccgtggcgtaggtgta
atgtgcgactactttgtagagaaagcggagaacgccacgctgtgggatgtggaaggcaat
gaagtgatcgactttgctgccgggatcgccgtgctgaataccggacatcgccatccgaag
attgtggcggcggtagagcagcagttgcaggcgtttacccataccgcttaccagattgtc
ccttatgagagttacgtctcactggcagaacgcattaatgctatcgcccctgtcgacggg
ccagcaaaaaccgcgttttttaccaccggtgccgaagcggttgaaaatgctgtaaaaatt
gcccgcgcctacactggacgcccgggacttattacctttggcggtggttttcatggccgt
acattcatgaccatggcgctgaccggcaaagtggctccctacaaaattggctttggcccg
ttcccgggctcggtttaccacgcggtctatccgaacgctgcccacggggtttccgttgac
gatgcgctcaagagcctggaacgtatctttaaagcggatatcgccgccgatcaggtcgcc
gcgattgtgctggagcccattcagggcgaaggcggtttcaacgtcgcgcccgccgctttt
atgcaggcgttgcgccagttgtgcgatacccacggcattttgctgattgccgacgaagtg
caaaccggctttgcccgtaccggcaaggtgtttgcgatgcagcactatgcggtgaaaccc
gatctgatgacgatggcgaaaagcttggcaggtggcttcccgctatcgggtgttgtgggg
cgtgccgaagtaatggatgcccctgcgccgggtggattaggcggaacttatgccggtaat
ccgctggcagtagccgccgcgcatgcggtgctggatattattgaagaagaacagctctgc
cagcgggctaatcaactgggtgagcatctgcaagaggtgctgaatcaggcgcgcgcaagc
tgtccggcgattgcggatgtgcgtggtctggggtcgatggtggcagtagagtttaacgat
ccgcaaagcggcgagccgtctgcggaatatacccgccaggtacagcgcaaagctcaggaa
aacggcctgctgctgttgagctgcggtgtctacggtaacgttatccgtttcctttatccc
ttaacaatcccggatgcccagttcagcaaagcgctggatattctggcccgtgtgctgcgc
gcctga

DBGET integrated database retrieval system