KEGG   Salmonella bongori N268-08: A464_4238Help
Entry
A464_4238         CDS       T02733                                 

Definition
(GenBank) Alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
sbz  Salmonella bongori N268-08
Pathway
sbz00473  D-Alanine metabolism
sbz01100  Metabolic pathways
sbz01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:sbz00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    A464_4238
 09160 Human Diseases
  09168 Drug resistance
   01502 Vancomycin resistance
    A464_4238
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:sbz01011]
    A464_4238
Enzymes [BR:sbz01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     A464_4238
Peptidoglycan biosynthesis and degradation proteins [BR:sbz01011]
 Precursor biosynthesis
  Racemase
   A464_4238
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Motif
Other DBs
NCBI-ProteinID: AGR61421
UniProt: S5MXM4
LinkDB All DBs
Position
4264817..4265896
Genome map
AA seq 359 aa AA seqDB search
MQAATVVINRRALRHNLQRLRELAPASKLVAVVKANAYGHGLLETARTLPDADAFGVARL
EEALRLRAGGITQPILLLEGFFDAADLPTISVQRLHTAVHNQEQLAALEAAELAEPVTVW
MKLDTGMHRLGVRPEEAEAFYQRLAHCKNVRQPVNIVSHFARADEPECGATEHQLEIFNA
FCRDKPGQRSIAASGGILLWPQSHFDWARPGIILYGVSPLEHKPWGPDFGFQPVMSLTSS
LIAARDHKAGEPVGYGGTWVSERDTRLGVVAMGYGDGYPRAAPSGTPVLVNGREVPIVGR
VAMDMICVDLGPSAQDKAGDPVVLWGEGLPVERIAEMTKVSAYELITRLTSRVAMKYID
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atgcaagcggcaactgtcgtcattaaccgccgcgctctgcgacacaacctgcaacgactg
cgtgaactggcgcctgccagcaaactggttgcggtggtgaaagcgaacgcttatggacac
ggtcttctggagaccgcgcgaacgctccctgatgccgacgcttttggcgttgcgcgcctt
gaagaagctctacgtctgcgagcgggcgggatcacgcagcctattctgctgctggagggg
ttcttcgacgccgccgatctgccgaccatttctgttcaacgcctgcataccgccgtgcat
aatcaggagcagcttgccgccctggaagctgcggaactggcggaaccggtaacggtgtgg
atgaagcttgataccgggatgcatcggctcggcgtgcgtccggaagaggcggaggcgttc
taccaacgtctggcgcactgtaaaaatgtacgccagccggtgaatatcgttagccatttt
gcgcgcgcggatgagccggagtgcggcgctaccgagcatcagcttgaaatttttaacgcc
ttctgccgggataaaccgggacagcgctccattgccgcctctggcggcattttgctgtgg
ccgcaatctcactttgactgggcgcgtccgggcatcattctttacggcgtatcgccgttg
gaacacaaaccctggggaccggattttggttttcagccggtcatgtctttaacgtccagc
ctgatcgcggcgcgcgaccacaaagcgggcgagccggtgggctacggcgggacatgggtg
agtgagcgcgatacgcgcctgggcgtggtggcgatgggctatggcgatggttatccacgc
gcggcgccttccggtacgccggtgctggttaacggtcgcgaggttccgattgtcgggcgg
gtggctatggatatgatttgtgtggatctgggacccagcgcccaggataaagcgggcgat
ccggttgtgttatggggtgaagggctgccggttgaacgtattgctgaaatgacaaaagta
agcgcttacgaacttatcacgcgtctgacctcaagggtggcgatgaagtatattgattaa

DBGET integrated database retrieval system