KEGG   Salmonella bongori N268-08: A464_4261Help
Entry
A464_4261         CDS       T02733                                 

Definition
(GenBank) Glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
sbz  Salmonella bongori N268-08
Pathway
sbz00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:sbz00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    A464_4261
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:sbz02000]
    A464_4261
Enzymes [BR:sbz01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     A464_4261
Transporters [BR:sbz02000]
 Other Transporters
  Pores ion channels [TC:1]
   A464_4261
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C GST_C_3 GST_C_2
Motif
Other DBs
NCBI-ProteinID: AGR61444
UniProt: S5N3E5
LinkDB All DBs
Position
4301780..4302448
Genome map
AA seq 222 aa AA seqDB search
MLTVHHLNQSRSQRILWALEELALPYQIVRYQREKTMLAPPALKKVHPLGKSPVIEDHGA
VIAESGAILEYLQETYDSIGRFKPADAQGKQHYRFWLHYAEGSLMPLLLMKLLFSSLGKP
PVPLGLRTLGGAIGKGAQKAYLTPQLETHARFIDGHLANHPWFAGEQLSMADIQMSFPLF
ALLARSGIGNLSHISAWKKRVEMRPAWQRAIQQGGPFSIPGE
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atgctgacggtgcatcatttaaatcagtctcgctcccagcgtatcctctgggcgctggaa
gaactggcgttgccttaccagattgtgcgttatcagcgtgaaaagacgatgctggcgccg
ccagccttgaaaaaagtgcacccactgggcaagtctccggttatcgaagatcacggcgcg
gtgattgcggaatcaggcgctattcttgagtatttgcaagagacttacgacagtattggg
cgttttaaaccggctgatgcgcaaggaaaacaacactatcgattttggctacattacgct
gaaggttcattaatgccattgctattgatgaagctgcttttttcctcattggggaagcca
ccagtgccattgggcctgcgcacattgggcggcgctattggtaaaggcgcgcaaaaagcg
tacctcactccgcaactggaaacccatgcgcgttttattgatgggcacctggcaaatcac
ccctggtttgccggtgagcaattaagtatggcggatatccagatgagcttcccgttattt
gcgctgcttgccagaagcgggatcggtaaccttagccatattagcgcatggaaaaagcgg
gtggaaatgcgtcccgcctggcagcgggcgattcagcagggcggtccgttttccatcccc
ggagaataa

DBGET integrated database retrieval system