KEGG   Salmonella bongori N268-08: A464_4497
Entry
A464_4497         CDS       T02733                                 

Definition
(GenBank) hypothetical protein
Organism
sbz  Salmonella bongori N268-08
SSDB
Motif
Pfam: TraU
Other DBs
NCBI-ProteinID: AGR61679
UniProt: S5N463
LinkDB
Position
complement(4552050..4553033)
AA seq 327 aa
MSIALHPAEEKSVAGGVMPDRFPLLLPLMLCAAFPLRAITTPEIAASALSPDCVNYRVVG
LCYWLYCTPLGCSVRTSVKVSHFRPDLVVSAYSNTGQSPWTEMSLLSPALPGIAESGGDT
NPRAASQHSKIRFKNADAIGFPAGDELAKFFTQFGYICSPSSQLFQPYFLSQLDTLAWRS
GVPEMTWPEALTPGMREVSQSGDMWGNIYPRAGAISQTHDYKAAAVIVQRVADLVTRTGQ
PHIYTPLTASSRAGYWPPSPVIEGDSDNHRWQMLTPKKSAACSVFPDGSVTDTYADRLAN
DGAYAWTLWRPYKCCPRRGQTFLGSTG
NT seq 984 nt   +upstreamnt  +downstreamnt
atgagcattgcgctacacccggcagaagaaaaatctgttgccggaggcgttatgccagac
cgctttcctcttctgttgcccctgatgctgtgcgccgctttcccgctcagagccattacc
acgccggaaattgccgcttccgccctgtcaccggactgcgtgaactatcgggttgtcggt
ctgtgctactggctctattgcacgccgctcggttgctcggtgcgcacgtcggttaaggtc
agtcatttccgtccggatctggtggtctcggcttacagcaacaccgggcaaagtccgtgg
acggagatgtcgttactaagcccggcgttacccggcattgccgaaagcggtggcgacact
aatccgcgagcggccagccagcacagcaagatccgctttaagaatgccgatgccatcggc
ttcccggcgggtgatgaactggcaaaatttttcacccagtttggctatatctgctcacct
tcatcgcagctttttcaaccgtactttctgagtcaactcgatacgctggcgtggcgcagc
ggggtaccggaaatgacctggccggaggcgctgacgccgggcatgcgggaagtcagtcag
agcggtgatatgtggggcaatatttaccctcgcgccggagccatcagccagacgcacgac
tataaagccgccgccgttatcgtccagcgcgtggccgatctggtgacgcgtaccgggcaa
ccgcatatctacacgccgctgacggcttcctcccgcgccgggtactggccgccctccccg
gttatcgaaggcgacagcgataaccatcgctggcagatgctcacgccgaaaaaatccgcc
gcctgttcggtgttcccggatggcagcgtcaccgacacttacgctgacagactggcgaat
gacggggcttacgcctggacgctgtggcggccctataaatgctgtccgcgccgggggcaa
accttcctcggcagtacgggttaa

DBGET integrated database retrieval system