KEGG   Salmonella bongori N268-08: A464_582Help
Entry
A464_582          CDS       T02733                                 

Definition
(GenBank) Alkyl hydroperoxide reductase protein F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
sbz  Salmonella bongori N268-08
Brite
KEGG Orthology (KO) [BR:sbz00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    A464_582
Enzymes [BR:sbz01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     A464_582
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_binding_2 FAD_oxidored HI0933_like FAD_binding_3 NAD_binding_8 Thi4 Glutaredoxin K_oxygenase AlaDh_PNT_C FMO-like DAO
Motif
Other DBs
NCBI-ProteinID: AGR57768
UniProt: S5MT46
LinkDB All DBs
Position
590240..591835
Genome map
AA seq 531 aa AA seqDB search
MMMFFKQEITMLDTNMKTQLKAYLEKLTKPVELIATLDDSAKSAEIKELLAEIAELSPKV
TFKENNSLPVRKPSFLITNPGSEQGPRFAGSPLGHEFTSLVLALLWTGGHPSKEAQELLA
QIRDIDGDFEFETYYSLSCHNCPDVVQALNLMAVLNPRIKHTAIDGGTFQNEITERNVMG
VPAVFVNGKEFGQGRMTLSEIIAKVDTGAEKRAAEALNKREAYDVLIVGSGPAGAAAAVY
SARKGIRTGLMGERFGGQVLDTVDIENYISVPKTEGQKLAGALKAHVSDYDVDVIDSQSA
SKLIPAASEGGLHQIETASGAVLKARSVIIATGAKWRNMNVPGEDQYRTKGVTYCPHCDG
PLFKGKRVAVIGGGNSGVEAAIDLAGIVEHVTLLEFAPEMKADQVLQDKVRSLKNVDIIL
NAQTTEVKGDGSKVTGLEYRDRVSGDTHQVALTGIFVQIGLLPNTQWLEGALERNRMGEI
IIDAKCETSVKGVFAAGDCTTVPYKQIIIATGEGAKASLSAFDYLIRSKVA
NT seq 1596 nt NT seq  +upstreamnt  +downstreamnt
atgatgatgttttttaagcaggagataacgatgctcgacactaacatgaaaacccagctc
aaggcctaccttgagaaactgaccaaacctgttgagctgattgccacgctggatgacagc
gctaaatcggcagaaatcaaggaactgctggcggaaatcgccgaactttcaccgaaagtg
acctttaaagaaaataacagcctgcccgtgcgcaagccctcttttctgatcaccaatcca
ggctcggagcaggggccgcgctttgcgggctcgccgctgggccatgaatttacctcgctg
gtgctggcgctgctgtggacgggggggcatccgtctaaagaggcgcaggaactgctggca
cagatccgcgatattgacggtgattttgagttcgaaacatattattccctttcctgccac
aactgcccggacgtggtacaggcgctgaacctgatggcggtgttgaatccacggattaaa
catacggcgattgacggcggcaccttccagaatgaaatcaccgagcgtaacgtaatgggg
gttccggcggtatttgtgaacggtaaagagttcggccagggacgtatgactctgagcgaa
attattgccaaagtggataccggggcagaaaaacgagcggcggaagcgttaaacaaacgc
gaggcgtatgatgtactgattgtcggttccggtccggcaggggcggcggcggcggtttac
tcggcgcgcaaggggattcgtaccggtttgatgggcgaacgttttggtggccaggtgctg
gatactgttgatatcgaaaactatatttcagtgccaaaaaccgaaggccagaaactggcg
ggcgcgctgaaagcgcatgtcagcgattatgacgttgacgtcattgatagtcagagcgca
agtaaactgattccggcagcgtcagaaggcggattgcatcagattgaaaccgcgtccggc
gcagtattgaaagcgcgcagtgttatcatcgccactggcgccaaatggcgtaatatgaat
gtgcccggtgaagatcagtatcgcaccaaaggcgtgacttattgcccgcattgtgacggt
ccactgtttaaaggcaagcgtgttgccgttattggaggcggtaactctggcgttgaagcg
gctatcgatctcgcagggattgtagaacacgttaccctgctggagtttgcgccggaaatg
aaagccgaccaggtattgcaggataaagtccgtagtctgaaaaacgtcgatattattctg
aatgcgcaaaccaccgaagtgaaaggtgatggtagcaaggttacgggtctggagtatcgc
gatcgcgtcagtggtgacacgcatcaggttgcactgacggggatcttcgtgcagatcggc
ctgctgccgaatacccagtggctggaaggcgcgctggaacgtaaccggatgggcgaaatt
atcattgacgccaaatgtgaaaccagcgttaagggggtctttgcggcgggtgactgtacc
actgtcccttacaagcagattattatcgccacaggcgagggggcaaaagcctcgcttagt
gcctttgattatctgattcgcagcaaagtcgcctaa

DBGET integrated database retrieval system