KEGG   Staphylococcus carnosus: SCA_0038Help
Entry
SCA_0038          CDS       T00863                                 

Gene name
ahpF
Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
sca  Staphylococcus carnosus
Brite
KEGG Orthology (KO) [BR:sca00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    SCA_0038 (ahpF)
Enzymes [BR:sca01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     SCA_0038 (ahpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox Thioredoxin_3 FAD_binding_2 GIDA HI0933_like FAD_oxidored NAD_binding_7 Thi4 DAO NAD_binding_9 K_oxygenase NAD_binding_8 FAD_binding_3
Motif
Other DBs
NCBI-ProteinID: CAL26953
UniProt: B9DID0
LinkDB All DBs
Position
complement(37836..39359)
Genome map
AA seq 507 aa AA seqDB search
MLKKELKSQLSQLLKLMEGDVVLTASYDDSEKSKELKDLLDEIADMSSHITVKEDTLERT
PSFSVDRPDERTGVVFAGVPLGHEFNSLVLALLQVSGRPPKEEQSVIDQIKALDKPLHFE
TFISLSCHKCPDVVQALNLMSVLNPNISHTMIDGAVFKEESKDIMAVPAVFLNGEEFGNG
RMSISDILNMLGSKADPAEYDNKEPFDVLVIGGGPASGTAAIYTARKGLRTGIVADRIGG
QVNETADIENFITVKETTGPEFSSALEQHINEYDIDVMDGMRATNIEKTEDGIVVTLDND
AKLKSKTVIISTGARFKNLDIPGEDELRNKGVAYCPHCDGPLFEGKDVAVVGGGNSGAEA
AIDLAGIVKHVTLVEYKDFLRADEILQERLQELPNVTILKNAQSSEIVGDDHVTGLKYTD
NKTGEKHQIDVEGVFVQIGLLPNTEWLEGAIDTNDGGEIIVDRKQSTSMPGVFAAGDVTD
DRFKQIIIAMGSGADAALNAFDYIIRN
NT seq 1524 nt NT seq  +upstreamnt  +downstreamnt
atgctgaaaaaagagttaaaatcacaattatcccaacttcttaaattaatggaaggcgac
gtggttttaacagcgagctatgatgacagcgaaaaatctaaagagttgaaagacctgtta
gatgaaattgctgatatgtcatctcatatcactgttaaagaggatacacttgaacgtact
ccaagttttagtgtagaccgccctgatgagcgcactggtgtagtttttgccggtgtgccg
ttaggtcatgaattcaactcacttgttctagctttattacaagttagcggacgccctcct
aaagaagagcaaagtgttatcgatcaaatcaaagctttagataaaccacttcatttcgaa
acatttatcagcttaagctgtcataaatgtcctgatgtggttcaagctttaaatttaatg
agtgtactgaacccgaatatttcacacacaatgattgatggcgcagtattcaaagaagaa
tctaaagatatcatggcagtaccggctgttttcttaaatggtgaagaattcggcaatgga
cgcatgagcatttctgacatccttaatatgttaggaagcaaagctgatccagctgaatat
gataataaagaaccttttgatgtattagtcatcggaggcggccctgctagtggtacagca
gcaatttacactgcacgtaaaggtttacgtacaggtattgttgcagatcgtatcggcggt
caagtgaacgaaactgcagatatcgaaaactttattactgttaaagaaacaacaggaccg
gaattctcatctgctttagaacaacacattaatgaatatgatattgatgtgatggatgga
atgcgtgcgactaacatcgaaaaaacagaagacggcatcgttgttacattagataacgat
gcaaaactgaaaagtaaaacagtgattatttcaactggtgcacgttttaaaaaccttgat
attcctggggaagatgaactgcgaaacaaaggtgtcgcatattgtcctcactgtgacgga
cctttatttgaaggtaaagatgttgcagtagtcggaggcggcaactctggtgctgaagca
gcaatcgacttagcaggtattgtaaaacacgtgacacttgtagaatataaagacttttta
cgcgctgatgaaattttacaagaacgtttgcaagaattaccaaacgtaacaatcttgaaa
aatgcacagtcttcagaaattgttggcgatgatcacgtaaccggccttaaatacacagat
aataaaactggcgaaaaacatcaaatcgatgtagaaggtgtattcgtacaaatcggttta
ttaccgaatacagaatggttagaaggtgccattgatacgaatgacggcggcgagattatt
gtagaccgcaaacaatcaacaagtatgccaggtgtattcgctgcaggcgatgttacagac
gatcgcttcaaacaaattattattgcaatgggttcaggtgcagatgctgcattgaatgca
ttcgattatattatccgtaactaa

DBGET integrated database retrieval system