KEGG   Staphylococcus carnosus: SCA_0840Help
Entry
SCA_0840          CDS       T00863                                 

Gene name
pknB
Definition
(GenBank) putative serine/threonine-protein kinase PknB
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
sca  Staphylococcus carnosus
Brite
KEGG Orthology (KO) [BR:sca00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sca01001]
    SCA_0840 (pknB)
Enzymes [BR:sca01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     SCA_0840 (pknB)
Protein kinases [BR:sca01001]
 Serine/threonine kinases: Other
  Bacterial family
   SCA_0840 (pknB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr PASTA APH RIO1 Kdo Pkinase_fungal Kinase-like FTA2
Motif
Other DBs
NCBI-ProteinID: CAL27750
UniProt: B9DPK3
LinkDB All DBs
Position
837586..839628
Genome map
AA seq 680 aa AA seqDB search
MMIGAIISDRYKIIEFLGGGGMSNVYLAEDSILDRKVAVKMIHIAPHEKEEMIRRFEREV
HNTSRLSHENIVNVIDVGENDEYFFLVMEYIEGPTLSEYIKTHGPLSIETAVNFAEQILN
GIQHAHEAGIVHRDIKPQNILVDRHKTLRILDFGIAKALSETAMTQTSHVLGTVQYLSPE
QAKGESTDMCTDIYSIGIVLYEMLVGEPPFTGETAVSIAIKHIQDPMPNASDKRSEIPQA
LSNVILKATEKNRSDRYQDTESMKKDLSSVLKTSRANESKYISDEAAAQTIAIDKNAIAK
QASPGPEAERKETKKESEHLNETMQIPIMQQQNLQSGEGHIYEIPKKKRSKKKKFFFALI
FLILLAGLITFLAFGMFGDKYTETPDLRGKTEAQAQQILKEHNIKVGKTTRTYSDKYQEN
QIVSTDPSPGDRVAEHDKVNIVLSKGPKKAHMPNLYGMTKADALEALKKLGFEKISMNQE
YSKMKLERGLIENQNIAADAYVPIKDTAIVLTESLGIKQVYVKDYTGESYEKASKELEEK
GLKPVKEKEEKSDKIEKGKIISQSPTSKSVDENSTVTFVVSSGKEDSSDSEEKEGTSASS
DDVKQVTETVKVPYSGKDGDSQKVEVFVRDKDHPGTSSSQTYNITSSRSVSIPLKIEKGK
TAGYTVRVDDKIVADKDVGY
NT seq 2043 nt NT seq  +upstreamnt  +downstreamnt
atgatgattggcgcaataatcagtgatcggtataaaataatagaatttctcggcggaggg
ggcatgagtaatgtctatctggctgaagattcgattttagaccgcaaagtcgctgtgaaa
atgattcatatcgcaccgcatgaaaaagaagaaatgattcgtcgatttgaacgtgaagta
cataatacttcacgcttatcgcatgaaaacattgtgaatgtgattgatgtcggagagaat
gatgaatactttttcttagtaatggaatatatagaaggtccgactttatcagaatatatc
aaaacacatggcccgctgagtattgaaactgcggtcaattttgctgagcaaatattgaat
gggattcaacacgcacatgaagcggggattgtacatagagatataaagcctcaaaatatt
ttagttgatcgtcataaaacgttaaggattttagatttcggtatcgcaaaagcgttaagt
gaaactgctatgacacaaacaagccatgttttgggaactgtgcaatatttgtctccagaa
caagctaaaggcgaatcgacagatatgtgcacagatatatattctatcggtattgtgctg
tatgaaatgttggttggagaaccaccgtttactggtgaaacggcagtgagtattgcgatt
aaacatattcaagatccaatgccgaatgcatcagataaacgttctgaaattccgcaagct
cttagtaatgtaattttaaaagcaactgagaaaaataggagtgatcgttatcaagacact
gaaagtatgaaaaaagatttaagcagtgtgttgaaaacatcacgcgcgaatgaatcgaaa
tatatttctgatgaagctgccgcacaaacgattgcgattgataaaaatgcaattgctaaa
caagcgagtcctggaccagaggcagaaagaaaagaaacaaaaaaagaatctgagcatttg
aatgaaacaatgcagattccaattatgcagcagcagaatttacaaagcggtgaaggtcat
atttatgaaattccaaagaaaaagcgttctaaaaagaaaaagtttttctttgcgttgatt
tttttgatcttactagcaggtttaattacatttttagcgttcggtatgtttggcgacaaa
tatactgaaacacctgatttaagaggtaaaacagaagcacaagcgcagcagattttaaaa
gagcataatataaaagtaggtaaaactacaagaacctacagtgataaatatcaggaaaat
caaatcgtgagtacggatccttcacctggagatcgtgttgctgaacatgataaggtaaat
attgttctttcaaaaggaccgaaaaaagcgcatatgcctaacttgtatggtatgacaaaa
gcagatgcattagaggcattaaaaaaacttggttttgaaaaaatatctatgaaccaagag
tattctaaaatgaaacttgagcgcggcttgattgaaaatcaaaatattgccgctgatgcc
tatgtacctatcaaagatacggcgattgtattaacggagtcgttaggtataaaacaagtt
tatgttaaagattacacaggtgaatcttatgaaaaagcttctaaggaactagaagaaaaa
ggattaaaaccagtgaaagaaaaagaagagaaaagcgataagattgaaaaaggtaaaatt
atctctcaatcaccgactagcaaatcagtagatgaaaattctacggtcacatttgttgtg
tcgtctggaaaagaggacagctcagatagtgaagaaaaagaaggcacttcagcaagttct
gatgatgttaaacaagtgactgaaacggttaaggtgccttattccggaaaagatggcgac
agtcaaaaagtagaagtttttgtaagagataaagatcatcctggtacatcttcatcgcaa
acgtataacattacaagcagtcgttctgtgtctattccattaaaaatagaaaaaggtaaa
acggcaggttatactgttcgtgttgatgataaaattgtcgcagacaaagatgtcggatat
taa

DBGET integrated database retrieval system