KEGG   Staphylococcus carnosus: SCA_0950Help
Entry
SCA_0950          CDS       T00863                                 

Gene name
glpD
Definition
(GenBank) aerobic glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
sca  Staphylococcus carnosus
Pathway
sca00564  Glycerophospholipid metabolism
sca01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sca00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    SCA_0950 (glpD)
Enzymes [BR:sca01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     SCA_0950 (glpD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 FAD_binding_3 FAD_oxidored Pyr_redox_2 GIDA NAD_binding_8 Pyr_redox Lycopene_cycl Thi4 HI0933_like 3HCDH_N
Motif
Other DBs
NCBI-ProteinID: CAL27858
UniProt: B9DP99
LinkDB All DBs
Position
960205..961875
Genome map
AA seq 556 aa AA seqDB search
MSLSTLKRNEIKDNFKNKEYDIVIIGGGITGAGVALDASQRGMKVALVEMQDFAQGTSSR
STKLVHGGLRYLKQLQVGVVAETGRERAIVYENGPHVTTPEWMLLPMHKGGTFGKFSTSI
GLAMYDRLAGVKKSERKKMLSKKETLAKEPLVKKDGLKGGGYYVEYRTDDARLTIEVLKR
AAEKGADILNYTKSMNFTYDDKEKVNGIQVTDMITDEPYTIHAKKVINASGPWVDEVRSA
DYSKNNKQLRLTKGVHIVIDQSKFPLQQAVYFDTEKDGRMIFAIPREEKAYIGTTDTFYN
NDKTSPLPTQEDRDYLIDAVNYMFPGLDIEDKDIESSWAGVRPLILEEGKDPSEISRKDE
IWEGKSGLLTIAGGKLTGYRHMAKGIVDLVSKRLQQEYKLKFKPCETKELKISGGDVGGS
ANYEQFVKEKTAEGEEYNLDHKTAEDIVRRYGSNADTLYQIAYTAQYQNSGLPIEIYAEL
VYGIQNEMVYKPTDFLIRRTGMLYFDIEDVKKYKDAVIDVMSQLLNYDAEQRALYVEELN
EAIEEATHGNNQPAEK
NT seq 1671 nt NT seq  +upstreamnt  +downstreamnt
atgagtttatcaactttaaaaagaaatgaaattaaagacaattttaagaacaaagagtat
gacatcgtaattattggtggaggtattacaggtgctggggttgccttagatgcttcacaa
cgcggaatgaaagtagcgcttgttgaaatgcaagactttgcgcaaggaacaagctctcgt
tcaactaaattagtacatggcggtttacgttacttaaaacagctgcaagttggggttgta
gctgaaactggacgtgaaagagcaatcgtttatgaaaatggaccgcatgtaacaacacca
gagtggatgttattgccaatgcataaaggtggtacattcggtaaattctctacttctatc
ggtttagcaatgtatgaccgtttagcaggagttaaaaaatcagaacgtaaaaaaatgttg
agtaaaaaagaaacgttagctaaagaaccattagtgaaaaaagatggtcttaaaggcggc
ggttattatgtagaatatcgtactgacgatgcgcgtttaacaattgaagtattaaaacgt
gcagctgaaaaaggtgcagatattttaaattatacaaaatctatgaacttcacttatgat
gacaaagaaaaagtaaatggtattcaagtgactgacatgattactgatgaaccatataca
attcatgctaaaaaagtcatcaatgccagcggaccttgggtagatgaagtacgcagtgca
gactactctaaaaacaataaacaattgcgtcttactaaaggtgtgcatattgttattgat
caatcaaaattcccgttacaacaagcggtttactttgatacagaaaaagatggacgtatg
atttttgcgattcctcgtgaagaaaaagcttatatcggtacaacagatacattctataac
aatgacaaaacatcaccgcttccaactcaagaagaccgtgattacttaattgatgcagtg
aattacatgttccctggattagatatcgaagataaagatattgaatcatcatgggcaggt
gtaagacctttaattcttgaagaaggtaaagacccatcagaaatttcacgtaaagatgag
atttgggaaggtaaatccggcttgcttactatcgctggtggtaaattaacaggctatcgt
cacatggctaaaggtatcgtagacttagtttctaaacgtctgcagcaagaatataaatta
aaattcaaaccatgtgaaacaaaagaacttaaaatctcaggcggagatgtaggcggcagt
gccaactatgaacaattcgttaaagaaaaaacagctgaaggcgaagaatataacttagat
cataaaactgcagaagatattgtaagacgatatggttcaaatgcagatacgttataccaa
atcgcatatacagcacaatatcaaaactctggattaccaattgaaatttatgcggaactt
gtatatggcattcaaaatgaaatggtttataaaccaacagatttcttaattcgtcgtaca
ggtatgttgtattttgatattgaagatgttaaaaaatacaaagatgcagttattgatgtt
atgtctcaattgttgaattatgatgcagagcaacgcgcgctttacgttgaagaattaaac
gaagcaattgaagaagcaacacatggtaataatcaacctgctgaaaaataa

DBGET integrated database retrieval system