KEGG   Staphylococcus carnosus: SCA_1471Help
Entry
SCA_1471          CDS       T00863                                 

Gene name
gatB
Definition
(GenBank) glutamyl-tRNAGln amidotransferase subunit B
  KO
K02434  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit B [EC:6.3.5.6 6.3.5.7]
Organism
sca  Staphylococcus carnosus
Pathway
sca00970  Aminoacyl-tRNA biosynthesis
sca01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sca00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    SCA_1471 (gatB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:sca03029]
    SCA_1471 (gatB)
Enzymes [BR:sca01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     SCA_1471 (gatB)
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     SCA_1471 (gatB)
Mitochondrial biogenesis [BR:sca03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    SCA_1471 (gatB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GatB_N GatB_Yqey GFP
Motif
Other DBs
NCBI-ProteinID: CAL28376
UniProt: B9DMT7
LinkDB All DBs
Position
complement(1494088..1495515)
Genome map
AA seq 475 aa AA seqDB search
MHFETVIGLEVHVELKTDSKMFSPSPAHFGAEPNSNTNVIDLAYPGVLPVVNRRAVDWAM
RASMALNMEIATESKFDRKNYFYPDNPKAYQISQFDQPIGEHGYIDIEVDGETKRIGITR
LHMEEDAGKSTHKDGYSLVDLNRQGTPLIEIVSEPDIRSPQEAYAYLEKLRSIIQYTGVS
DCKMEEGSLRCDANISLRPYGQEEFGTKAELKNLNSFNYVRKGLEYEEKRQEEELLNGGE
VLQETRRFDESTGKTILMRVKEGSDDYRYFPEPDIVPLYVDEAWKERVRQTIPELPDARK
EKYVNEYGLPAYDAHVLTLTKEMSDFFEGAVEAGADVKLTSNWLMGGVNEYLNKNQVELQ
DTKLTPENLAGMIKLIEDGTMSSKIAKKVFPELAENGGDAKQIMEDKGLVQISDESVLLN
FVNEALDNNPQSVEDFKNGKGRAKGFLVGQIMKASKGQANPQMVNKLLQQELDKR
NT seq 1428 nt NT seq  +upstreamnt  +downstreamnt
atgcattttgaaacagtgattggacttgaagtccatgttgagttgaaaacagactctaaa
atgttctctccatcacctgcgcatttcggagcagaaccaaactcaaatacaaatgtaatc
gacctagcatacccaggtgtcttgccagttgtaaacagacgtgctgtagactgggcaatg
cgtgcatcaatggctttaaatatggaaattgcgacagaatcaaaattcgaccgtaaaaac
tatttttatccagataatccgaaagcttaccaaatttctcaatttgaccaaccaatcgga
gaacacggttatattgatatcgaagtagacggcgaaacaaaacgtatcggtattacacgt
cttcatatggaagaagatgctggtaaatcaacacataaagatggttactcattagttgac
ttaaaccgtcaaggtacgccattaattgaaattgtttcagaaccagatatccgttcacct
caagaagcttatgcatatcttgaaaaattacgttctattatccagtatacaggtgtttct
gactgtaaaatggaagaaggttcattacgttgcgatgcgaacatttcattacgtccttat
ggccaagaagaattcggtacaaaagctgaattgaaaaacttgaactcattcaactatgtt
cgaaaaggtcttgaatatgaagaaaaacgccaagaagaagaattattgaatggcggagaa
gtattgcaagaaacacgtcgttttgatgaatcaactggtaaaactattttaatgcgtgtt
aaagaaggatcagatgattaccgttacttcccagaaccagatatcgtaccattgtacgtt
gatgaagcatggaaagagcgcgtacgtcaaacaatccctgaattaccagatgcacgtaaa
gaaaaatacgtgaatgaatatggcttacctgcatatgatgcacatgttttaactttaact
aaggaaatgtctgatttctttgaaggtgctgtagaagcaggtgcagatgttaaattgaca
tctaactggttaatgggtggtgtaaatgagtacttgaataaaaaccaagttgaacttcaa
gatactaaattaacacctgaaaaccttgctggcatgattaaattaattgaagacggtact
atgagcagtaaaattgctaaaaaagttttcccagaattagctgaaaatggcggcgatgct
aaacaaattatggaagataaaggtttagttcaaatctcagatgaatctgtattattaaac
ttcgttaacgaagctttagataataatcctcaatctgttgaagactttaaaaacggtaaa
ggccgtgcaaaaggcttcttagttggacaaatcatgaaagcttctaaaggacaagctaac
ccgcaaatggtaaataaattgttacaacaagaattagataaacgctga

DBGET integrated database retrieval system