KEGG   Staphylococcus carnosus: SCA_1625Help
Entry
SCA_1625          CDS       T00863                                 

Definition
(GenBank) putative aldehyde dehydrogenase family protein
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
sca  Staphylococcus carnosus
Pathway
sca00010  Glycolysis / Gluconeogenesis
sca00071  Fatty acid degradation
sca00280  Valine, leucine and isoleucine degradation
sca00310  Lysine degradation
sca00330  Arginine and proline metabolism
sca00340  Histidine metabolism
sca00380  Tryptophan metabolism
sca00410  beta-Alanine metabolism
sca00561  Glycerolipid metabolism
sca00620  Pyruvate metabolism
sca00625  Chloroalkane and chloroalkene degradation
sca01100  Metabolic pathways
sca01110  Biosynthesis of secondary metabolites
sca01120  Microbial metabolism in diverse environments
sca01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:sca00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SCA_1625
   00053 Ascorbate and aldarate metabolism
    SCA_1625
   00620 Pyruvate metabolism
    SCA_1625
  09103 Lipid metabolism
   00071 Fatty acid degradation
    SCA_1625
   00561 Glycerolipid metabolism
    SCA_1625
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SCA_1625
   00310 Lysine degradation
    SCA_1625
   00330 Arginine and proline metabolism
    SCA_1625
   00340 Histidine metabolism
    SCA_1625
   00380 Tryptophan metabolism
    SCA_1625
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    SCA_1625
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    SCA_1625
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    SCA_1625
Enzymes [BR:sca01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     SCA_1625
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh VASP_tetra
Motif
Other DBs
NCBI-ProteinID: CAL28531
UniProt: B9DMD5
LinkDB All DBs
Position
complement(1641514..1642941)
Genome map
AA seq 475 aa AA seqDB search
MRIQTKQYINGEWVDSASGETLDVINPANEEVLGKIAKGNKEDVDKAVDAANDVYLEFRH
SSVEFRRDLLDKIVQEYKNRKDDIVEAITDELGSPLEVSKNVHYEMGLAHFTEARDALDN
FEFEEKRGDDLVVKEAIGVAGLITPWNFPTNQTSLKLAAAFAAGSPVVLKPSEMTPFAAI
ILAEIFDKVGVPKGVFNLVNGDGEGVGNPLSENPKVRMMSFTGSGPTGAKIMKKAADDFK
KVSLELGGKSPYIILDDSDIDGAAEAAVGKVYNNTGQVCTAGTRTIVPESMKDDFIKAAK
EKMSQVKVGDPREKGVQMGPIISKKQFDQVEDYIQKGIDEGAELVLGGVGKPEGLEKGYF
AKPTIFANVTNDMTIAQEEIFGPVMSIITYKDLNEAIKIANDTKYGLAGYVYGKDLNTLR
KVAREIEAGTIEINEAGRKPDLPFGGYKQSGLGREWGDYGIEEFLEIKSIAGYYE
NT seq 1428 nt NT seq  +upstreamnt  +downstreamnt
ttgagaattcaaactaaacaatatatcaatggcgaatgggtggacagtgcaagtggtgaa
acacttgatgttattaacccagctaatgaagaagtattaggtaaaattgcaaaaggcaat
aaagaagatgtagataaagcagtagatgctgcaaatgatgtttaccttgaattccgtcac
agtagtgtagaatttagaagagatttattagataaaatcgtacaagagtataaaaataga
aaagatgatattgtagaagcaattacagatgaattaggttcaccgcttgaagtttctaag
aatgtgcattacgaaatgggtcttgcgcactttactgaggcaagagatgcattagataac
ttcgaatttgaagaaaaacgcggtgatgacttagttgtgaaagaagcgattggtgtagca
ggtttaattacaccttggaacttcccaacaaaccaaacatctttaaaattagcagctgcg
tttgcagcaggctctccagttgtgttgaaaccttctgaaatgacaccatttgctgcaatt
attttagcagaaatctttgacaaagtcggcgtaccaaaaggtgtgttcaacttagtaaat
ggtgatggtgaaggtgtcggcaatccattaagtgaaaatccaaaagtacgtatgatgtca
tttactggttccggcccgactggtgctaaaatcatgaaaaaagctgcggatgacttcaag
aaagtatcattagaattaggtggtaaatctccttatattattcttgatgattcagatatt
gatggtgcggctgaagcggcagtaggtaaagtctataacaatacgggtcaagtttgtaca
gcaggtacacgtacaattgttcctgaatctatgaaagatgactttatcaaagcagctaaa
gaaaaaatgagccaagttaaagtaggcgaccctagagaaaaaggtgttcaaatgggccct
attatcagtaaaaaacaatttgatcaagttgaagactatattcaaaaaggtatcgatgaa
ggtgctgaacttgtattaggcggtgtcggcaaacctgaaggattagaaaaaggttatttt
gctaaaccaactatctttgctaatgtgacaaatgatatgacaattgcacaagaagaaatc
ttcggtcctgtaatgtcaattatcacttacaaagacttaaatgaagcaattaaaatcgca
aatgacactaaatatggtcttgctggctatgtttatggtaaagacttgaatactttaaga
aaagtagcacgtgaaattgaagcaggcacaatcgaaatcaatgaagctggtcgtaaacca
gacttaccattcggcggttataaacaatcaggtcttggccgtgaatggggtgactacgga
attgaagaattcctagaaattaaatcaatcgcaggttattatgaataa

DBGET integrated database retrieval system