Shewanella carassii: TUM17387_36040 Help Entry TUM17387_36040    CDS       T07543                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism scaa  Shewanella carassii Pathway scaa01100   Metabolic pathways scaa01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:scaa00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     TUM17387_36040   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     TUM17387_36040 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  BCV68245 LinkDB All DBs Position 4122427..4122681 Genome browser AA seq 84 aa AA seqDB search MSLHNEIKQLIIDCLDLEDISIDDIDTEAPLFGEGLGLDSIDALELGLAIKKQFDVKIEA NSEATKAHFYSVASLAAFIESQRA NT seq 255 nt NT seq  +upstreamnt  +downstreamnt atgagcttacataacgaaattaaacagctaatcatagattgcctcgatcttgaggatatc agtatcgacgatatagataccgaagcaccgctgttcggtgaggggttgggactggattcc atcgatgcacttgagctgggcttggcgatcaagaagcagttcgacgtcaagatcgaagcc aactcagaggcaaccaaggcccacttttacagtgtggccagccttgccgcgtttatcgaa tcccagcgcgcgtag

DBGET integrated database retrieval system