KEGG   Serinus canaria (common canary): 103812477Help
Entry
103812477         CDS       T05755                                 

Definition
(RefSeq) trypsin I-P38-like
  KO
K01312  trypsin [EC:3.4.21.4]
Organism
scan  Serinus canaria (common canary)
Pathway
scan04080  Neuroactive ligand-receptor interaction
scan05164  Influenza A
Brite
KEGG Orthology (KO) [BR:scan00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    103812477
 09160 Human Diseases
  09172 Infectious disease: viral
   05164 Influenza A
    103812477
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:scan01002]
    103812477
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:scan04147]
    103812477
Enzymes [BR:scan01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.4  trypsin
     103812477
Peptidases and inhibitors [BR:scan01002]
 Serine peptidases
  Family S1: chymotrypsin family
   103812477
Exosome [BR:scan04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   103812477
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin DUF1986
Motif
Other DBs
NCBI-GeneID: 103812477
NCBI-ProteinID: XP_009083796
LinkDB All DBs
Position
Unknown
AA seq 171 aa AA seqDB search
MKCLLLLAFIGVAVAFPTFAEDDDDKIVGGYTCARNSVPYQVSLNSGYHFCGGSLISSQW
VLSAAHCYKSRIQVRLGKHNLELTESTQQLINSAKVIRHSGFNTYTLNNDIMLIKLATPA
TLSSAVQTIPLPTSCVAAGTTCLISGWGNTLSSGSEYSGGMYRPSWAQDSL
NT seq 516 nt NT seq  +upstreamnt  +downstreamnt
atgaagtgcctgctgcttcttgcctttattggggtggctgttgccttccccacctttgct
gaagatgatgatgacaagattgtgggaggctacacctgtgcaaggaactctgtgccctat
caggtgtccctgaattctggatatcacttctgtggaggttccctcatcagcagccagtgg
gtcctgtcagctgctcactgctacaaatctcgcatccaagtgcggctcgggaaacacaat
ctggagctcaccgaatccacacagcagttgatcaactctgctaaagtcatccgccactct
ggcttcaacacctacaccctgaacaatgacatcatgctcatcaagctggccaccccagcc
acgctcagcagtgctgtccaaaccattcctctgcctaccagctgcgtggccgccggcacc
acctgcctgatctccggctggggcaacactctcagcagtggcagtgagtactctggggga
atgtacagaccctcgtgggcccaggacagtctctga

DBGET integrated database retrieval system